KEGG   Rattus norvegicus (rat): 29134
Entry
29134             CDS       T01003                                 

Gene name
Axin2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    29134 (Axin2)
   04390 Hippo signaling pathway
    29134 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29134 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29134 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    29134 (Axin2)
   05225 Hepatocellular carcinoma
    29134 (Axin2)
   05226 Gastric cancer
    29134 (Axin2)
   05217 Basal cell carcinoma
    29134 (Axin2)
   05213 Endometrial cancer
    29134 (Axin2)
   05224 Breast cancer
    29134 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29134 (Axin2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29134 (Axin2)
   05022 Pathways of neurodegeneration - multiple diseases
    29134 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    29134 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    29134 (Axin2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    29134 (Axin2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 29134
NCBI-ProteinID: NP_077331
RGD: 69259
Ensembl: ENSRNOG00000055010
UniProt: O70240
Position
10
AA seq 838 aa
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSEPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHQQCHAL
LPTGGKLPPEAACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCLCP
GGTDYYCYSKCKSHSKPPEPLPGEQFCGSRGGTLPKRNTKGTEPGLALPAREGGMSSAAG
APQLPGEEGDRSQDVWQWMLESERQSKSKPHSTQSIRKSYPLESARAPPGERVSRHHLLG
ASGHPRSAARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRDRN
HPATGQAGPTSFSNPSLASEDHKEPKRLASVHALQASELIVTYFFCGEEIPYRRMLKAQS
LTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgagtagcgctgtgttagtgactctccttccagatccaagcagcagcttccgcgaggat
gctccgcggcccccggttcccggagaagaaggggagaccccaccgtgtcagcctagcgtg
ggcaaggtccagtccaccaaacctatgcctgtctcctctaacgctaggcggaatgaagat
gggctgggggagcccgaggggcgggcctccccagattcccctctgaccaggtggaccaag
tctttgcactccttgttgggggaccaagatggtgcatacctcttccggactttcctggag
agggagaaatgtgtggataccctggacttctggtttgcctgcaatgggttcaggcagatg
aacttgaaggataccaaaactttgcgagtggccaaagcaatctacaagaggtacattgag
aacaacagtgttgtctccaaacagctgaaacccgccaccaagacctacataagagatggc
atcaagaagcagcagatcggctcggtcatgtttgaccaggcgcagacggagattcaggcg
gtgatggaggaaaatgcctatcaggtgttcttgacttctgacatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagcaatgggggactggggagcctaaaggtc
ttatgtggctacctccccaccctgaatgaggaagaggagtggacatgtgccgacctgaag
tgcaaactttcacccaccgtggttggcctatccagcaaaactctccgggccacagcgagc
gtgagatccacagaaacggctgaaaacggattcagatccttcaagagaagcgaaccggtt
aatccttatcacgtaggttctggctatgtctttgcaccagccaccagcgccaacgacagc
gagttatccagcgacgcgctgaccgacgattccatgtccatgacagacagtagcgtagat
ggaatccctccttaccgcatggggagtaagaaacaactccagagagagatgcaccgcagt
gtgaaggccaatggccaagtgtctctacctcacttcccgagaacccaccgcctgcccaag
gagatgacgcccgtggaacctgctgccttcgccgcagagctcatctccaggctggagaag
ctgaaactggagctggagagccgccacagcctggaggaacggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggtccaa
caccccctggccctcttaccctctggcagctatgaagaggacccacaaaccatcttggac
gaccacctgtccagggtcctcaagacccccggctgccagtcccctggtgtgggccgctac
agcccacgctcccgctcccccgaccaccaccaccaccaccatcagcagtgtcacgccctt
cttccaactgggggcaagctgccccccgaggctgcttgcccgctccttggaggcaagagc
ttcctgaccaaacagacgacgaagcacgtccaccaccactacatccaccaccacgccgtc
cctaagaccaaggaggagatcgaggcagaagccacacagagagtacgctgcctctgccct
ggaggcacagattattactgctactccaagtgcaagagccactcgaagcctccagagccc
ctccctggggagcagttttgtggcagcagaggtggcaccttgccaaaacggaatacgaaa
ggcacagaaccgggtctggcactgccggccagggaaggagggatgtccagtgcagcaggg
gcccctcagcttcctggggaagaaggagaccggtcacaggatgtctggcagtggatgttg
gagagtgagcgtcagagcaagtccaagccccatagtacccaaagcataagaaagagctac
ccgttggagtctgcccgcgcgcccccaggcgaacgagtcagccggcaccatctgctgggg
gccagtggacacccccgctcagcggcccgggctcacccatttacccaggaccctgccatg
cctcccctaaccccacccaacaccttggcgcagctagaggaagcctgccgcaggctggcc
gaggtgtcaaagccccagaaacagaggtgctgcgtggccagtcagcagagggacaggaac
cacccagccacaggtcaggcaggacccacatccttctccaacccgagcctggcttcagaa
gatcacaaagagccaaagagactggctagtgtccacgcactccaagccagcgagctgatt
gttacctactttttctgtggagaagaaattccatacaggaggatgctgaaggcgcagagc
ttgactctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtattacttc
aagaaggcgagtgacgaatttgcctgtggagcagtctttgaggagatctgggatgatgag
acagtgctccccatgtacgaaggcaggatcctgggcaaagtggagaggatcgactga

KEGG   Rattus norvegicus (rat): 79257
Entry
79257             CDS       T01003                                 

Gene name
Axin1
Definition
(RefSeq) axin-1
  KO
K02157  axin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    79257 (Axin1)
   04390 Hippo signaling pathway
    79257 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    79257 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    79257 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    79257 (Axin1)
   05225 Hepatocellular carcinoma
    79257 (Axin1)
   05226 Gastric cancer
    79257 (Axin1)
   05217 Basal cell carcinoma
    79257 (Axin1)
   05213 Endometrial cancer
    79257 (Axin1)
   05224 Breast cancer
    79257 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    79257 (Axin1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    79257 (Axin1)
   05022 Pathways of neurodegeneration - multiple diseases
    79257 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    79257 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    79257 (Axin1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     79257 (Axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 79257
NCBI-ProteinID: NP_077381
RGD: 620859
UniProt: O70239
Structure
PDB: 
1WSP 2D5G

Position
10
AA seq 832 aa
MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSE
TSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLL
DFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQ
QIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMS
GYLPTLNEDEEWKCDQDADEDDGRDSVPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYG
SWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRRE
MQESVQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKR
VRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQ
RVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHAPKLGLKLDSAGLHHHRHVHH
HVHHNSARPKEQMEAEAARRVQSSFSWGPETHGHAKPRSYSESTGTNPSAGDLAFGGKAS
APSKRNTKKAESGKNASAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQ
QAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRL
EEEEKRANKLPSKQRTKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQF
KELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgcagagtcccaaaatgaatgtccaggagcagggtttccccttggacctcggagcaagt
ttcaccgaagatgccccccggcccccagtgcctggagaagagggagaactggtatccact
gattcgaggcctgtcaaccacagtttctgctctgggaaaggtaccagcattaaaagtgag
acctcaacagccaccccaagacgttcagatctggatctgggatatgagcctgagggcagt
gcctcccccaccccaccatacttgaggtgggctgagtcactgcattccttactggatgac
caagatgggatcagcctgttcaggactttcctgaagcaggagggctgtgctgacctgctg
gacttctggtttgcctgcagtggcttcagaaagcttgagccttgtgactcaaatgaggaa
aagaggctgaagctggcaagagccatctaccgaaagtacatcctggatagcaatggcatt
gtgtccagacaaaccaagccagccactaagagcttcataaaggactgcgtcatgaagcag
cagatcgatcctgccatgtttgaccaggcacagacagaaatccagtccaccatggaggag
aacacctacccttccttccttaagtctgacatttatttggagtacacaaggacaggctca
gaaagtccaaaggtctgcagtgaccagagctcagggtccgggacagggaagggcatgtct
ggatacttgcccactttgaatgaagatgaagaatggaaatgtgaccaagatgcagatgag
gatgatggccgagactctgtcccccccagcaggctcacccagaagctgctattggagact
gctgccccgagggccccctcaagtagacggtacaacgaaggcagagagctcaggtatgga
tcttggagggagcctgtcaacccctactatgtcaactctggctatgccctggccccagcc
accagtgccaatgacagtgagcagcagagcctgtccagtgatgctgacactctatccctc
acggacagtagcgtggatggaatccccccatacaggatccgtaagcagcaccgaagggag
atgcaggagagtgtccaagtcaatgggcgggtacctctacctcacattcctcgcacttac
cgaatgccaaaggagatccgggtagagccacagaaatttgctgaagagcttattcaccgt
ctagaggctgtccagcgtactcgagaggctgaagaaaagttggaggaacggctgaagcgt
gtacgcatggaggaagaaggggaagatggggaaatgccttctggccccatggcaagtcac
aagctgccttctgtcccagcttggcaccatttcccacctcgctatgtggatatgggctgc
tccggactgcgggatgcccatgaggagaatcctgagagcatcctggatgagcatgtgcaa
agggtcatgaggacacctggctgccagtcacctggcccaggccaccgctctcctgacagc
gggcatgtggccaagactgcagtgctagggggtacagcatctgggcatgggaagcatgct
cctaagttagggttgaagctggattcagctggcctgcaccaccataggcacgtccaccac
cacgttcaccataattcagctagacccaaggagcaaatggaggctgaagctgcccgcagg
gtccagagcagcttctcatggggcccagaaacacatggtcatgccaagccccgaagctat
tcagagagcacaggcaccaaccccagtgctggggacttggcctttggtggtaaagctagt
gcaccctccaaaagaaacaccaagaaggctgaatctgggaagaatgccagtgctgaggta
cccagtaccacagaggatgcagagaagaaccagaagatcatgcagtggatcattgagggg
gagaaggagatcagtagacaccggaaggcaggccatgggtcttctgggatgaggaagcag
caggcccatgaaagctccaggcccttgtccattgaacgtcctggggccgtgcacccctgg
gtcagtgctcagcttcggaactctgtccagccttctcatctcttcatccaagatcccaca
atgccacccaatccagcccctaatcctctgacccagctggaagaggcccgcaggcgtttg
gaggaagaagaaaagagagcaaacaaactgccctccaagcagaggacaaaatcacaaaga
aaggcaggtggcgggagtgcaccaccatgtgacagtatcgttgtggcctactatttctgt
ggtgaaccaataccctaccggaccctggtgaggggccgtgctgtcaccctgggccagttc
aaggagctgctaaccaagaaggggagctacagatactactttaagaaagtgagtgacgag
tttgactgtggtgtggtatttgaggaagtacgggaagatgaggccatcctgcctgtcttt
gaagaaaagatcatcggcaaggtggaaaaggtggactga

DBGET integrated database retrieval system