KEGG   Rattus norvegicus (rat): 291794
Entry
291794            CDS       T01003                                 

Symbol
Snrpd1
Name
(RefSeq) small nuclear ribonucleoprotein Sm D1
  KO
K11087  small nuclear ribonucleoprotein D1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    291794 (Snrpd1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    291794 (Snrpd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    291794 (Snrpd1)
   03032 DNA replication proteins [BR:rno03032]
    291794 (Snrpd1)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   Sm proteins
    291794 (Snrpd1)
  U2 snRNP components
    291794 (Snrpd1)
 Complex B
  U1 snRNP components
    291794 (Snrpd1)
  U4/U6.U5 tri-snRNP components
    291794 (Snrpd1)
 Complex C
  U2 snRNP components
    291794 (Snrpd1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     291794 (Snrpd1)
SSDB
Motif
Pfam: LSM Gemin7 Hfq SM-ATX API5
Other DBs
NCBI-GeneID: 291794
NCBI-ProteinID: NP_001099633
RGD: 1306345
Ensembl: ENSRNOG00000013714
UniProt: B2RZB7
Position
18
AA seq 119 aa
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaagctcgtgagatttttgatgaaattgagtcatgaaaccgtaaccattgaattgaag
aatggaacgcaagtccatggaacaatcacaggtgtagatgtcagcatgaatacgcacctt
aaagctgtgaaaatgaccctgaagaacagagagcctgtacagttggaaacattgagtatt
cgaggcaataacattcggtattttattctaccagacagtttacctctagatacactactt
gtggatgtcgaacctaaagtgaagtctaagaaaagagaggctgttgcaggaagaggccga
ggccggggtagaggaagaggacgtggtcgtggcagaggaagagggggtcctaggcgataa

KEGG   Rattus norvegicus (rat): 687711
Entry
687711            CDS       T01003                                 

Symbol
Snrpd3
Name
(RefSeq) small nuclear ribonucleoprotein Sm D3
  KO
K11088  small nuclear ribonucleoprotein D3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    687711 (Snrpd3)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    687711 (Snrpd3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    687711 (Snrpd3)
   03032 DNA replication proteins [BR:rno03032]
    687711 (Snrpd3)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   Sm proteins
    687711 (Snrpd3)
  U2 snRNP components
    687711 (Snrpd3)
 Complex B
  U1 snRNP components
    687711 (Snrpd3)
  U4/U6.U5 tri-snRNP components
    687711 (Snrpd3)
 Complex C
  U2 snRNP components
    687711 (Snrpd3)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     687711 (Snrpd3)
SSDB
Motif
Pfam: LSM Kringle
Other DBs
NCBI-GeneID: 687711
NCBI-ProteinID: XP_003751996
RGD: 1597573
Ensembl: ENSRNOG00000050410
UniProt: M0R907
Position
20
AA seq 126 aa
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ
VYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN
IFQKRR
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtctatcggtgtgccaattaaagtcctgcacgaagcggaaggccacatagtgacatgt
gagaccaacactggtgaagtgtatcgggggaagctcattgaggcagaggacaacatgaac
tgccagatgtccaacatcacagtcacatacagagacggccgagtggcacagctggaacag
gtgtacatacgtggcagcaagatccggtttctgattttgcctgacatgctgaaaaatgca
cccatgttaaagagcatgaaaaataaaaaccaaggctcaggggctggccgaggaaaagct
gctatcctgaaggcccaagtggctgcaagaggaagaggacgtggaatggggcgtggaaac
attttccagaagcgaagatag

DBGET integrated database retrieval system