KEGG   Rattus norvegicus (rat): 29190
Entry
29190             CDS       T01003                                 

Gene name
Pdyn
Definition
(RefSeq) proenkephalin-B preproprotein
  KO
K15840  proenkephalin B (prodynorphin)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29190 (Pdyn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    29190 (Pdyn)
   05022 Pathways of neurodegeneration - multiple diseases
    29190 (Pdyn)
  09165 Substance dependence
   05030 Cocaine addiction
    29190 (Pdyn)
   05031 Amphetamine addiction
    29190 (Pdyn)
   05034 Alcoholism
    29190 (Pdyn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29190 (Pdyn)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29190 (Pdyn)
SSDB
Motif
Pfam: Opiods_neuropep
Other DBs
NCBI-GeneID: 29190
NCBI-ProteinID: NP_062247
RGD: 62054
Ensembl: ENSRNOG00000026036
UniProt: F1M7S3
Position
3
AA seq 248 aa
MAWSRLMLAACLLVIPSEVTADCLSLCSLCAVRTQDGPHPINPLICSLECQDLVPPSEEW
ETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTELTKLLEPLLKELEKGQLLTSVSEEK
LRGLSSRFGNGRESELLGTDLMNDEAAQAGTLHFNEEDLRKQAKRYGGFLRKYPKRSSEM
AGDEDRGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPN
TYSEDLDV
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcgtggtccaggctgatgctggcagcttgcctccttgtgatcccctctgaggttaca
gcagactgcctgtccttgtgttccctgtgtgcagtgaggacgcaggatgggccccatccc
atcaaccccctgatttgctccctggagtgccaggacctggtgccgccctcggaggagtgg
gagacatgccggggcttttggtcttttctcaccctgactgcctctgggctccatggcaag
gatgacttggagaatgaggttgctttggaagaaggctacacggaactgaccaagctcttg
gagcccctcctgaaggagctggagaaaggccaactccttaccagcgtctcagaggaaaag
ctcaggggtctctccagcaggtttggcaacggaagagaatctgagctactgggcactgac
ctgatgaatgatgaagccgcacaggctggcacgctccatttcaacgaggaggacttgaga
aaacaggccaaacgctatggcggctttttgcgcaaataccccaagaggagctccgagatg
gctggggacgaggacaggggccaggatggggatcaggtagggcatgaggacctgtacaaa
cgctatgggggcttcctgcggcgcattcgccccaagcttaagtgggacaaccagaaacgc
tatggtggttttctgcggcgtcagttcaaggtggtgactcggtcccaggagaaccccaat
acctattccgaagatttagatgtttga

DBGET integrated database retrieval system