KEGG   Rattus norvegicus (rat): 291927
Entry
291927            CDS       T01003                                 

Symbol
Orc6
Name
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    291927 (Orc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    291927 (Orc6)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    291927 (Orc6)
SSDB
Motif
Pfam: ORC6
Other DBs
NCBI-GeneID: 291927
NCBI-ProteinID: NP_001028862
RGD: 1311437
Ensembl: ENSRNOG00000024043
UniProt: Q3T1K3
Position
19
AA seq 262 aa
MESDLVRHLARRLGLGEPSVLRKAEEYLRLSKVKCVSLSAHTSETSNAVICLDLAASCRK
CPLDRAYLIKLSGLNKKMYQSCLKSFECLLGLNSNIGLRDLAVQFSCTEAVNLAAGILQS
YESSLPEAQRADLDLSRPLFTTAALLSACKILKIKVDKTKMITTSGVKKTIFDRLCTQLE
KIGQQINRDSADLASPALKKKKPAFSPALKKKKSGLEQPAKDIEVIETSDKLPKDAGLTQ
DYEEWKRKILENAAKAQTAAVE
NT seq 789 nt   +upstreamnt  +downstreamnt
atggagtcggatcttgtaaggcacctcgcccggcgcctcggcctcggggagccgagtgta
ctgaggaaagcagaggagtacctgcggctgtctaaagtgaagtgtgtcagtctgtctgca
cacacctcagaaaccagcaatgctgtcatatgcctggaccttgcagcgtcctgtaggaag
tgccccttggatagagcgtatctaattaagctctctggtttgaacaagaagatgtatcag
agctgtcttaaatcttttgagtgtttgctggggttaaactcaaatattggattaagagac
ctggctgtgcagttcagctgtacagaagccgtgaacttggctgcggggatactgcaaagc
tatgagtctagtcttccggaagcacagcgagcagatcttgacttgtccaggccacttttc
accacggcggctctactctcagcatgcaaaattctaaagataaaggtggataaaaccaaa
atgataactacatccggtgtgaaaaaaacaatatttgatcgactgtgtacacagctagaa
aagatcggacagcaaattaacagagactctgcagatttagctagtccagccctgaagaaa
aagaagccagcgtttagtccagcactgaagaaaaagaagtcagggcttgaacaaccagca
aaagacatagaagtaatagaaacctcagataaactaccgaaagacgcaggtctgacacag
gattatgaggaatggaaaaggaagattttggaaaatgctgccaaagcgcaaacagccgca
gtggagtga

KEGG   Rattus norvegicus (rat): 295596
Entry
295596            CDS       T01003                                 

Symbol
Orc4
Name
(RefSeq) origin recognition complex subunit 4
  KO
K02606  origin recognition complex subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    295596 (Orc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    295596 (Orc4)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    295596 (Orc4)
SSDB
Motif
Pfam: ORC4_C AAA_16 AAA AAA_22 ATPase_2 AAA_19 NACHT AAA_14 T2SSE DUF815 AAA_18 DAP3 NB-ARC TniB cobW DUF2075 AAA_23 AAA_29 ABC_tran KAP_NTPase G-alpha AAA_7 Septin AAA_30 AAA_33 SRPRB Rad17 RsgA_GTPase MobB AAA_24 AAA_5 Mg_chelatase MMR_HSR1 Zeta_toxin
Other DBs
NCBI-GeneID: 295596
NCBI-ProteinID: NP_954523
RGD: 735212
Ensembl: ENSRNOG00000005021
UniProt: Q6P9Z8
Position
3
AA seq 434 aa
MSNRKSKNNIHAECLSQVQRILRERFCHHTPHSNLFGVQVQYKHLIELLKRTAIYGESNS
LLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLNLEN
VVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDISQS
AQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPD
KIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFMTSADL
MEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQRKAH
SVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQKYSNCP
TDVRQWATSSLSWL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagcaatcgtaaaagcaagaataacatacatgcagagtgtctttcccaggtacaaaga
attttacgtgaaaggttttgtcatcatactcctcatagcaacctatttggagtgcaagta
caatacaagcatttaattgagctactcaaaagaactgctatctatggagaaagtaattct
ttactcattgttggaccacgaggatcaggaaagaccacgttattaaatcatgccttgaaa
gagctcatgcaaataggagacatgagtgaaaatgtgttacaagttcacttaaatggactg
ctacagacaaatgataaaattgctctgaaagagatcacaagacaattaaatctagaaaat
gtagttggagataaagtttttggaagctttgctgaaaacctttcgtttcttctggaagct
ttgcagaaaggtaaccggactagcagttgcccagtgatcttcatactggatgaatttgat
ctttttgctcatcagaaaaaccaaacactcctttataatctttttgacatttctcaatct
gcacagacaccaatagcagttattggccttacatgtagactggatattttggaactctta
gaaaagagagtgaagtcacgattttctcaccggcagatacatttaatgaattcatttgat
tttccgcaatatttgaaaatatttaaagaacaattatctctacctgcagaattcccagat
aagatttttgctgagaaatggaatgagaatgctcattgtctctccgaagattcaactgtg
cttgaagttctacagaagcatttcaatgtcaacaaaaacttgcaatcattacatatgcta
ttgatgcttgctttaaatcgagtaaccgtgacacacccatttatgacctcagcagatctg
atggaggcgcagcacttgtgtagcttggatgccaaagcgagtattgtacatggtctgtca
gtcttggaaatctgtcttataatagcaatgaaacatttaaatgacatatatgaagaggag
ccctttaattttcaaatggtgtataatgaatttcagaaattcattcaaagaaaggcccat
tctgtttataactttgagaaacctgtggtcatgaaggcatttgagcacttacaacaattg
gaattaataaaacccatggaaagaacctcagtcaattctcagagagaataccagctagtc
aaactacttttggataatactcagattatgaatgccctacagaaatactccaactgccct
acagatgtcaggcagtgggcaacatcctcgctcagctggctgtga

KEGG   Rattus norvegicus (rat): 301430
Entry
301430            CDS       T01003                                 

Symbol
Orc2
Name
(RefSeq) origin recognition complex subunit 2
  KO
K02604  origin recognition complex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    301430 (Orc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    301430 (Orc2)
   03036 Chromosome and associated proteins [BR:rno03036]
    301430 (Orc2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    301430 (Orc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     301430 (Orc2)
SSDB
Motif
Pfam: ORC2
Other DBs
NCBI-GeneID: 301430
NCBI-ProteinID: NP_001012003
RGD: 1311844
Ensembl: ENSRNOG00000012558
UniProt: Q75PQ8
Position
9
AA seq 576 aa
MSTLRLKEAKVPSVQFVGDDDVLSHILDREGGTKLKKEKVQLLVNPQKVIKKAECELEKS
DLEVLEDQNYVEVLGRNIQESLGNGSAVDGRNKVYSFQHRKHPEEMTKLALELAKTSGKI
DPLASNDPKITKNIARKSKGHSSEKAPLENNNKNEFPSIQPHNVRKRLIASRSHCDSESE
YSASSSEDDEEVAKDDEEDTNVVRCSKKSQGQNRLLPAPVSKEILPKKRKRDKAGDLVEE
YFEAHSSSKVLTSDRTLQKLRRARVDQKTLRNLLSKFVPSFSTEIGQLNQQHERLFDKWI
LQLRLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVINGFFPGISVKSILNSITEDVLSH
MGTFQSVLDQRDWIMNRFKEDSSLELFLLIHNLDSQMLRGDNSQQILGQLSSLRNVYLIA
SIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHVLR
SLTPNARGIFRLLMKYQLDNQDCPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDH
KLIRTKKGTDGVEYLLIPVDSGTLADFLEKEEEEES
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgagcacactgcggttaaaggaagccaaggtgccaagcgttcagtttgtgggagatgac
gatgttcttagtcacattctggatagagaaggaggaactaaattaaagaaggagaaagtt
cagcttttggtcaatccccagaaagtaataaagaaggcagaatgtgaattagagaaaagt
gacctggaagtcttagaggatcagaactacgtggaagtcttgggaagaaatattcaagaa
tccttgggaaatggctctgctgtagatggtaggaataaagtttattcttttcaacacaga
aaacaccctgaagagatgactaaattggctttagaactggcaaaaacatcaggaaaaatt
gatccacttgcctcaaacgatcctaaaatcacgaaaaacattgctcgaaaaagcaaaggg
cattcttcagagaaagctccgctggagaacaataacaaaaatgaatttccgtcaatacaa
cctcataatgtaagaaaaagattaatagcatcaaggtctcattgtgacagtgaaagtgaa
tattctgcttccagctcagaagatgatgaagaggttgcaaaagacgatgaagaagacact
aatgtggtcaggtgctcgaaaaagagtcaaggtcagaatagactacttccagctcctgtt
tccaaagagatactgcccaagaaaaggaagagagacaaagcaggtgacttggtagaagaa
tattttgaagcccacagtagttcaaaagtcttaacgtctgatagaacgctgcagaagctg
aggagagcgagagtggaccagaaaactctgcgtaacttactgagcaaatttgtgccttcc
ttttctactgaaattggacagttgaatcaacagcatgagagattgtttgataagtggata
ctacagttacgccttgggttcaacattgtgctttatggtttggggtctaagagagattta
ctagaaaagtttcgaactaccatgcttcaagattccattcatgttgtcatcaacggcttc
tttcctggcatcagtgtaaaatcaatcctgaactctataactgaagatgtcctcagtcac
atgggtactttccaaagtgttctggatcagcgagactggataatgaacagatttaaagaa
gattcttctttagaactctttcttcttatccacaatttggatagccagatgttaagagga
gacaatagccagcaaattcttggacagttgtcatccttacgtaatgtgtatctcatagca
tctatcgaccacctcaatgctcctctcatgtgggatcatgcaaagcagagtctgtacaat
tggctgtggtatgaaaccactacatacagtccttacaccgaagaaacctcctatgagaac
tcccttttggttaaacagtctggatctctaccactgagttctctgattcatgtcttacga
agccttacacccaatgcaagggggattttcaggctacttatgaagtaccaactggataac
caggactgcccttcctacattggactttcttttcaagatttttaccagcagtgtcgggaa
gcattccttgttaacagtgatctcacactccgagcccagttaactgaatttagggaccac
aaacttataagaacgaagaagggaactgatggtgtggagtatttattaattcctgttgac
agcggaacattggccgatttcttggagaaggaggaggaggaggagtcgtag

KEGG   Rattus norvegicus (rat): 313138
Entry
313138            CDS       T01003                                 

Symbol
Orc3
Name
(RefSeq) origin recognition complex subunit 3
  KO
K02605  origin recognition complex subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313138 (Orc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    313138 (Orc3)
   03036 Chromosome and associated proteins [BR:rno03036]
    313138 (Orc3)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    313138 (Orc3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     313138 (Orc3)
SSDB
Motif
Pfam: ORC3_N ORC3_ins ORC_WH_C DUF1793
Other DBs
NCBI-GeneID: 313138
NCBI-ProteinID: NP_001020453
RGD: 1308457
Ensembl: ENSRNOG00000008314
UniProt: Q4R180
Position
5
AA seq 711 aa
MATSSVSKGCFVFKPDFKKRKISVPIEDYFNNEELDSEDSKLRFETYRLLWQRIKSETEQ
LQEGLNENLFDNLVDFLQKSHSEFQKNSGNWGSQMRLREIPTAALILGVNVTDHDVIFRS
LTETLHNNVTPYVVSLQAKDCPDVKHFLQKLTSELIDCCVDRNSKEEKNDKALRRTSYSM
DSLSSWYSTVAQKTGPKMTSKKRATCSQWQSPPVVLILKNMESFSTKVLQDFIIISSQHL
HEFPLILIFGIATSPVIIHRLLPHSVSSLLCIELFQSLSCKEHLTVVLDKLLLTPQFPFK
LSKKALQVLTNIFLYHDFSIQNFIKGLKLSLLEHFYSQPLSVLCCDLSEAKKRINVFSVN
QCEKIRRLPSFRRYVENQPLEKQVALLTNETFLKEETQSLLEDLHVYHINYFLVLRCLHN
FTSSLPKYPLGRQIRELYCTCLEKKIWDSEEYESALQLLRMLAKDELMGILEQCVKVLNS
STEKQLSNTAQKIKGFLTQFQNLDDSKEEEDACGSQPKGLQKTDLYHLQKSLLEMKELRR
TTKKPTKFEMLRENVINFIDNLVRDYLLPPEGQPLHEVVYFSAANTLREHLNAAPRIALH
TALNNPYYYLKNEALKSEEGCIPSVAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAE
KMDTNSTVSEEMSEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggccacctcctccgtgtccaagggctgttttgtgtttaaaccagacttcaaaaaaaga
aagatctctgtgccaatagaggactattttaataatgaggaacttgactcagaagacagt
aaacttcgatttgaaacatatcgcttgctatggcaacggataaaatctgaaacagagcaa
ttacaggagggattaaatgaaaatctgtttgataacctagttgactttctgcagaagtcc
cattctgaatttcagaaaaattcaggaaactggggctctcagatgagactcagagaaatt
ccaacagctgctcttattcttggcgtgaacgtcacagatcatgacgtgatattcaggagt
ctaacagagacccttcacaataatgtcacaccgtatgtcgtctccctgcaagctaaggat
tgtccagatgtgaaacattttttacagaagttgacctctgagttgatagactgctgtgta
gatagaaattccaaggaggagaaaaatgacaaagccctgaggaggaccagttattccatg
gattcgctttctagttggtattcgacggttgcacagaagacaggccccaaaatgacaagc
aaaaagagagcgacttgtagccaatggcagtcccctcctgtggtgcttatcttaaagaac
atggagagtttcagcacaaaagtactgcaggacttcataattatcagcagtcagcatctg
catgagtttcctctaattctcatttttgggatcgccacatctcctgttattatccaccga
ctgcttcctcattcagtgtcatctctgttgtgtatagaactgttccagtctctgtcttgc
aaggaacacctgacagtagttcttgataagctgcttcttacccctcagtttccctttaaa
ttgagtaaaaaggcattacaagttctgaccaacatctttttgtatcatgatttctcaatt
caaaacttcatcaaaggacttaagctttctctactagaacatttttattctcagccccta
agtgttctgtgctgtgatctctcagaagccaaaaaaagaataaatgttttctcagtcaat
caatgtgaaaaaatccggcgccttccttcatttaggaggtacgtggaaaatcaacctttg
gaaaagcaagttgcactgttgaccaatgagacctttttaaaggaggaaacgcaatcattg
ttggaagacctgcatgtttaccatatcaattacttccttgttttgagatgtcttcataat
tttacctcttctcttcccaagtacccactgggtcgacagattagggagctgtattgtaca
tgtttggaaaagaagatatgggattcggaggagtacgaatcagccttgcagttgctgaga
atgctggcaaaggacgaactgatgggcatacttgagcagtgtgttaaggttttgaattcc
tctactgaaaagcagcttagcaacacagcacagaaaataaagggcttcctgacccagttt
cagaaccttgatgatagcaaagaggaagaggatgcttgtggttcacagccaaaggggctg
cagaagacggacctgtaccaccttcagaagtccttactggaaatgaaagagctaaggaga
acaactaagaagccaaccaagtttgaaatgctcagagaaaatgttataaacttcatcgac
aacctggtgagagactaccttctgcctcccgagggccagcctctgcatgaggtagtgtac
ttcagtgctgccaacacactccgagagcacttaaatgctgctccaagaatcgccctccac
actgcactcaacaacccttactattacctaaagaatgaagcattgaaaagtgaggaaggc
tgcattccaagtgttgcccctgacatctgcatagcatataaactgcacctggagtgtagt
cggctgattaaccttgtcgactggtcagaggcttttgcaacagttgtgacagctgctgag
aaaatggatacaaattctacagtctccgaagaaatgagtgaaatcatccatgctcgattt
attagagctgtttctgaattagaacttttaggctttataaaacctacgaaacagaagact
gaccatgttgcaaggctcacatggggaggctgctaa

KEGG   Rattus norvegicus (rat): 313479
Entry
313479            CDS       T01003                                 

Symbol
Orc1
Name
(RefSeq) origin recognition complex subunit 1
  KO
K02603  origin recognition complex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313479 (Orc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    313479 (Orc1)
   03036 Chromosome and associated proteins [BR:rno03036]
    313479 (Orc1)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    313479 (Orc1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     313479 (Orc1)
SSDB
Motif
Pfam: Cdc6_C BAH AAA AAA_22 AAA_16 AAA_lid_10 AAA_30 AAA_19 NACHT DUF2075 NB-ARC SpoU_methylas_C
Other DBs
NCBI-GeneID: 313479
NCBI-ProteinID: NP_808792
RGD: 631435
Ensembl: ENSRNOG00000008841
UniProt: Q80Z32
Position
5
AA seq 848 aa
MPSYVTRQKTRQTFSWVGRPLPNRKQFYQMYKEICMKINGCSEIHIKVGQFVLIQGEDNQ
KPYVAKLIELFENGSEVPPKKYARVQWFVRFCEIPIPKRHLLGRRPSAQEIFWYDCSDCD
NDIHVETIIGPVQVVALAPEDEIPVNQKSEETLFVKLSWNKKNFAPLPPEELAALRRLEC
QKPLEAKTKSVKSPSWSTAEQEVKRIESSHSTSRSYQDPAHTVTPNAMKSLECGGFTRKP
NMRLSRKILCDSLDSQKTCKRRAAFSETTSPPKKPQPGEIKTSSALETLGKNGHTQPFFA
KSSMVLRTRGTAVKTTKLTVESALSPVRSRSRYSVAPSVGLTPQYIGRKAKEQETHKEPI
HTSLRARRRSSLLTLKRIKQQLWLLDDDKSDQEEEESISSVEVSDSSSEEEDESVPSPPT
GKPVGQSRTRRTASKPSSQTPSKSPKKTFRPRPPLHATPQIRDRNLAVQEPASVLEEARL
RLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQ
AAQTNDVPPFEYVEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCSRGSQKE
TTVLLVDELDLLWTHKQDVLYNLFDWPTHKGARLVVLTIANTMDLPERIMMNRVASRLGL
TRMSFQPYSHSQLKQILVSRLKHLKAFEDDAVQLVARKVAALSGDARRCLDICRRATEIC
EVSHQRGDSQCLVTVAHLMEAIDEMFSSSYITAIKNSSVLEQSFLRAIIAEFRRSGLEEA
TFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRILLVEPSRNDLLLRVRLNVSQND
VLYALKEE
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgccgtcctatgtcacaaggcagaagaccagacaaactttctcatgggttggcaggcca
ttgccgaatcgaaaacagttctaccaaatgtacaaagaaatttgtatgaaaatcaatggt
tgttctgagattcacatcaaggttggacagtttgtattgattcaaggggaagataatcaa
aagccctatgttgctaaactgattgaattatttgaaaatgggtctgaagttcctcccaag
aaatatgcgcgagtacaatggtttgtccgattctgtgagattcctatccctaaaaggcat
ttgttaggacggagaccttctgcacaggagatattctggtatgactgttctgactgtgat
aacgacattcatgtggagaccatcattggccctgttcaggtagtggcattagccccagaa
gacgagatccctgtgaatcagaaaagtgaggagacactgtttgtgaagctgtcctggaat
aaaaagaactttgcgccactgccaccagaagaacttgcagcattgaggagactggagtgc
caaaaacctttagaagccaagactaagagtgttaaaagcccttcctggagcacagcagaa
caagaggtcaaaaggattgaatcaagtcattccacttccagatcttaccaggatcctgct
catactgtcactcccaacgcaatgaagtctctggaatgtggtggttttaccaggaagcct
aacatgaggctgtcacggaagatcttgtgtgattccttggattctcaaaaaacatgtaaa
cgaagagcagccttctctgagaccacctcaccacctaaaaagcctcaacctggtgaaatc
aagacctcctcagctttggaaactctaggaaaaaatgggcatactcaacccttttttgcc
aaaagtagcatggttctgagaacccggggcacagctgtgaagaccacaaagcttactgtg
gagagtgcacttagccctgtcaggagcaggtcgaggtactcagtggcaccctctgtgggt
ctgacacctcaatacattgggaggaaggcaaaagaacaagaaactcacaaagaacccatc
catacttctcttcgtgcccgtagaaggagttctctcttgactttgaagcggattaagcaa
cagctttggcttctagatgatgataaaagtgaccaagaagaggaagagtccatatcctct
gtggaagtgtcagactccagtagtgaggaggaagatgagtctgttccctcccctccaaca
ggaaaacccgtggggcagtccaggacccggagaactgcctctaagccatcatcacagacc
ccctccaagtcaccaaagaaaacttttagacctagaccacctcttcatgctactcctcag
atccgagacagaaacttggctgtccaagagccagctagtgtgcttgaagaggcccggctc
aggctgcatgtttctgccgtgcctgactctcttccctgtcgagagcaggagttccaagac
atctacagctttgtggaaagtaaacttcttgatggaaccggagggtgtatgtacatttct
ggggtccctgggacagggaagacagccactgtgcatgaagtcatacgctgtctgcagcag
gcagcacaaacaaatgatgttcctccctttgaatacgttgaggttaatgggatgaagctg
acagaaccccaccaggtctatgtgcagattttacagaaactgacaggccagaaggcaaca
gctaatcatgcagcagaactgctggcaaagcaattctgcagccgagggtcccagaaggaa
accactgtgctgcttgtggatgagcttgaccttctttggactcacaaacaagatgtgttg
tacaacctctttgattggcctactcacaaaggagcccggttggtcgtgttgactattgcc
aataccatggaccttccagagaggatcatgatgaaccgtgtggctagccgcctgggcctc
accaggatgtctttccaaccctactctcacagccaactgaaacaaatcttagtgtcccga
ctgaagcatttaaaggcctttgaggatgatgccgtccagttggtagccagaaaggtagca
gccctttctggagatgcccggcgctgcctggacatctgcaggcgtgccacagagatctgc
gaggtttcccatcagcgtggtgactctcagtgcctggtgactgtggcccacttaatggaa
gctatagatgaaatgttttcctcatcctatattactgccatcaaaaactcttctgtcctg
gaacagagcttcctgagagccatcattgcggaattccgtcgatcaggactggaggaagct
acatttcaacagatatacagtcagcatgtggctctgtgcagaatggagggactgccttac
ccaaccatgtcagagaccatggccgtgtgctcgcgtctgggttcttgccgcattcttctg
gtggagcctagcaggaatgacctactccttcgagtgagactcaatgttagccagaatgat
gtgctgtatgctctcaaagaagagtga

KEGG   Rattus norvegicus (rat): 362304
Entry
362304            CDS       T01003                                 

Symbol
Orc5
Name
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362304 (Orc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    362304 (Orc5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    362304 (Orc5)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     362304 (Orc5)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    362304 (Orc5)
SSDB
Motif
Pfam: ORC5_C AAA_16 AAA_22 Microtub_bd Arf Kinesin AAA_24
Other DBs
NCBI-GeneID: 362304
NCBI-ProteinID: NP_001014208
RGD: 1561088
Ensembl: ENSRNOG00000011519
UniProt: Q5M7U2
Position
4
AA seq 435 aa
MSHLESMVLCREAQVSTLQSLFGEREHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHAF
VNCVECFTSRLLLEQILNKLSHLSSSEAECSTETTCETFNDFVRLFKQVTSAEHLKDQTV
YIVLDKADYLRDMEANLLPGFLRLQELTDRNVTVIFLSEIIWEKFRPNTGCFEPFVLHFP
DYSIGNLQKILSHDHPPGYSADFYSAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEAGERDTRKLWRNIEPHLKKAMQTVYLREVSSSQWETLQKDATDLGQLKGLSAYTHV
ELPYYSKFILIAAYLASYNPARTDRRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTVVGHEDQLNGPKYKCTVSLDFIRSIA
RTVNFDIIKYLYDFL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtctcacttggagagcatggtgctctgtcgagaggcccaagtgtccactttgcagtcc
ctgtttggagagagagagcacttcagctttccgtccatcttcatttatggacacactgcc
agtgggaagacctatgtgacacagacattgttgaaaactttagagctcccacatgccttt
gtgaattgtgttgaatgttttacttcaaggctacttttggaacaaattttaaacaagctg
agtcatcttagttcttcagaggcagagtgttctacagaaacgacttgtgaaacatttaat
gactttgtccggttgtttaagcaagtgaccagtgctgaacatctcaaggatcagactgtg
tatattgttctggataaagctgactatctgagagacatggaagcaaatctcttgcctggg
tttcttaggctgcaagagttgactgacagaaacgtgactgttatcttcctcagtgagatt
atttgggaaaaatttcgtccaaacactggatgcttcgagccatttgtcttacacttccct
gactacagcatagggaaccttcaaaagatcctgtcccacgatcatcctccagggtattca
gctgacttttactctgcctacattaatattctccttggagttttctacactgtctgtcga
gatctgaaagagctcagacacctggcagtgcttaatttccccaaatattgtgagcctgta
gttaaaggagaagcaggtgagcgtgatactcgcaaactgtggagaaatattgaacctcac
ttgaagaaggccatgcagacggtgtatctgagggaggtctcaagttcgcagtgggaaaca
ttacagaaagatgccacagacctgggacagctgaaagggctctcggcgtacacccatgtg
gagcttccatattactccaagtttattcttattgctgcgtaccttgcctcttacaacccc
gcgagaacggacaggaggttcttcctaaagcatcatggaaaaatcaagaaaactaacttt
ctaaagaaacatgagaagacaagcaatcatcttcttggaccaaagccatttccattggac
agattattagcaatattatatagtatagtggacagcagagtggctccaactgcaaacatc
ttctcccagattacctccctagtgactcttcagctgttaaccgtagttggtcatgaagat
caacttaatggaccaaaatacaaatgcacagtttctctagatttcatcagatctattgcg
cggacggtgaactttgacataataaaatacttgtatgatttcttgtga

DBGET integrated database retrieval system