KEGG   Rattus norvegicus (rat): 293047
Entry
293047            CDS       T01003                                 

Gene name
Kif7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X3
  KO
K18806  kinesin family member 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    293047 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293047 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    293047 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    293047 (Kif7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     293047 (Kif7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 293047
NCBI-ProteinID: XP_006229476
RGD: 1310310
Ensembl: ENSRNOG00000026857
Position
1
AA seq 1340 aa
MGLEAQKLSGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPERGRITLGRDRHFGFHVV
LGEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRAPTRLPRPGA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERVPEEQAAGARGPPRHRSETRIIHRGRRVLCPGVGSAAVAPGLGTECARCRARTSAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESAPADDQAAQGTSGR
KGDEGAQQLLILQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
AQPGWGAPGLLQGLSPGSFVPRPHTAPLGGAHTHMTGTMPRTCLPGEEVSSEQQVANGKE
AKAELLAQVDKLGSASSTTSEEEEEEEEEPPRRTLHLRRNGISNWSQRAGVRPGSPPDRK
GPEVCPEEPAAAIPAPQVGGSKAPGQTRQAPAAMASEWRLAQAQQKIRELAINIRMKEEL
IGELVRTGKAAQALNRQHSQRIRELEQEAERVRGELCEGQRQLRELEGREPQDASERSRL
QEFRKRVAAAQSQVQVLREKKQATERLVSLSAQSETRLQELERNVQLMRRQQGQLQRRLR
EETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRNRRSGSNGSVVSLE
QQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKTGLESKRMRS
SQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSALNQQQIRGEIDTLRQEKDSLLKQRLE
IDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQCEMN
LMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEVALE
RQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIQALEKELGRHMWI
NQELKQKLSAGNTAGQSRGCERRSHCLENRQGLGNEDGPHVAAQEPLWPSSLLEGAPRVW
DESRDLVHAPLPLTWKRSSLCSEQGSSEEPRARETTEPPVGRVLPMGEVSLSWNFGPLPK
PRWEPRRTSPGMIDVRKNPL
NT seq 4023 nt   +upstreamnt  +downstreamnt
atggggctggaggcccagaagctgtcgggggctgaggaggccccagtgagggtggccctt
cgagttcgccccttgctgcccaaggagctgctccatggtcatcagagttgcctgcaggtg
gagcctgagcgtggtcgaatcaccctgggtcgtgaccgccattttggattccatgtggta
ctgggagaggacgccgggcaagaggctgtgtaccaggcttgcgtgcagcccctcctcgag
gctttctttgagggcttcaatgccaccgtctttgcctatggtcaaacaggctctgggaag
acgtataccatgggggaggccagcgtggcctccctgcatgaagatgagcaaggtattatc
ccaagggccatggctgaggccttcaagctcatcgatgagaatgacctgctggactgcctg
gtacacgtatcctacctggaactgtacaaggaagagttccgagatctgctcgaagtgggc
actgccagccgggacatccagcttcgggaagatgatcggggaaatgttgtgctctgtggg
gtgaaagaagtggacgtggaaggcctggacgaggtgctgagcctcctggagatgggcaac
gctgcgcggcacacaggagccacacacttcaaccgcctctccagccgctcgcacacagtc
ttcactgtgaccctggagcagagaggacgggctcctacccgcttgcctcgacctggcgct
ggccacctgctggtctctaaattccacttcgtggacctggcaggctctgagagggttctg
aagaccggcagcaccggcgaacggctcaaagagagcatccagattaacagtaccctgctg
gccctgggaaatgtcattagtgctctgggagacccccagcgccgaggcagccacatccct
taccgtgactccaagatcacccggatcctcaaagactctctgggagggaatgccaagaca
gtgatgatcgcctgcgtcagcccctcctcctccgacttcgatgaaacccttaacacccta
aactacgccagccgtgcccagaacatccgcaatcgtgccacagtcaactggcgtccagaa
gccgagcgtgtccctgaggaacaggcggcgggtgcgcgcgggccgccgcgacaccgctcg
gagacgcgcatcatccaccgtggccggcgcgtgctctgcccaggggtgggctccgcggca
gtcgctccggggctgggcactgagtgcgcgcgctgccgggcccgcaccagcgccgcctac
agcctcctgcgagagctgcaggccgagcctgggctaccgggcgctgctgcccgcaaagtg
cgggactggctgtgcgcggtggagggtgaacgcagcgccctgagctctgcctctgggccc
gacagcggcatcgaaagcgctccagctgatgaccaggcggcacaggggaccagcgggaga
aagggagatgagggggcccagcagctgttgatcctgcagagccaagtggcccggctagag
gaggagaatcgagacttcctggcggctttggaggacgccatggagcagtacaaactgcag
agcgaccgcctgcgggagcagcaggaagagatggtggaacttcggctacgcctagagctg
gcacagcctggctggggagcaccggggctcctgcagggcctgtcaccaggatccttcgta
ccccggcctcacacagcccccctggggggtgcccacactcacatgacgggcacgatgccc
cggacatgtctccctggagaagaagttagttctgagcagcaggtggcgaatggcaaggaa
gccaaggcggagttgttggcccaggtggacaagctgggcagtgcctcctccactacatca
gaggaggaagaggaggaggaggaggagccacccaggaggaccttacacctgcgcaggaat
ggaatcagcaactggagtcagagggcaggggtgcgtcctgggagcccacctgacaggaag
ggcccagaggtctgcccagaagagccagctgctgccatcccagcaccacaagtcggtggt
agcaaggccccgggtcagacccgccaggccccagctgccatggcctccgagtggcgactg
gcccaggcccagcagaagatccgggaactggccatcaacatccgcatgaaggaggagctc
attggtgagctggtccgcacagggaaggcggcccaggccctgaaccgccagcacagccaa
cgcattcgggagctggagcaggaggccgagcgagtgcggggggagctgtgtgaagggcag
aggcagcttcgtgagctggagggcagggagcctcaggatgccagcgagaggtccaggctt
caggaattccgtaagagagtggctgcagcccaaagccaggtgcaggtactgagggagaag
aagcaggcaacagagcggctggtgtcactgtcggctcaaagtgagactcggctacaggag
ctggagaggaatgtgcagctcatgcggcgacagcaggggcagctgcagaggcggctccga
gaggagacagagcagaagcggcgtctagagacggagatgaacaagagacagcatcgtgtc
aaggagctggagctgaagcatgagcaacagcagaagatcctgaaaatcaagacagaagag
attgcagccttccagaggaatagacgcagtggcagcaatggctctgtggtgagcctggag
cagcagcagaaaattgaggagcagaagaagtggctggaccaggagatggaaaaggtgcta
cagcagcggcgggcgctggaggagttgggagaggagctccgcaagcgggaggtcattctg
gctaagaaggaggccctgatgcaggagaagactggactagagagcaagcgcatgaggtct
agccaggccctaaatgaagacatcgtgcgcgtgtccagccgtctagaacacctggagaag
gagctatctgagaagagtggtcagctgcggcaaggcagcgccctgaaccaacagcagatc
cgaggggagatagacaccctgcgccaggagaaggactcgctgctgaagcaacgcctggag
atcgatagcaagctgaggcagggaagcctgctgtcacctgaggaggagaggacactgttc
cagctggatgaagccatagaggccctggatgctgccatcgagtacaagaatgaggctatt
acatgccgccagcgggtgctgcgggcctcggcctccttgctgtcccagtgtgagatgaat
ctcatggccaagctcagctacctttcttcctcagagaccagagccctgctgtgcaagtat
tttgacaaggtggtgactctcagagaggagcaacaccagcaacagattgccttctcggag
ctggagatgcagctggaggagcagcagcggctggtgtattggctggaggtggccctggag
cggcagcgcctggagatggaccgccagctgacgctgcagcagaaggagcatgagcagaac
gtgcagctgctccttcagcagggtcgagaccaccttggcgaggggttagcagacagcaag
aggcaatatgaggcccggattcaagctctggagaaggaactaggtcgacacatgtggata
aaccaggagctcaaacaaaagctcagtgcgggaaacactgcaggccagagccggggttgt
gagaggagaagccactgcctggaaaatagacaaggccttggaaatgaagatgggccccat
gtagcagctcaggaacctctctggccatcttcccttctggaaggggcaccccgtgtgtgg
gatgagtcccgggacttggtccacgccccgctacctctgacatggaaacgctcaagcttg
tgcagtgaacagggctcctctgaggagcctagggcacgggaaacaacagaacccccagta
gggcgggtgctacccatgggtgaagtgagcctctcctggaactttggacccttgcctaag
cctcggtgggaaccccgaagaaccagcccagggatgatcgacgtcaggaaaaaccccttg
tag

DBGET integrated database retrieval system