KEGG   Rattus norvegicus (rat): 293624
Entry
293624            CDS       T01003                                 

Gene name
Irf7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    293624 (Irf7)
   04621 NOD-like receptor signaling pathway
    293624 (Irf7)
   04622 RIG-I-like receptor signaling pathway
    293624 (Irf7)
   04623 Cytosolic DNA-sensing pathway
    293624 (Irf7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    293624 (Irf7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    293624 (Irf7)
   05160 Hepatitis C
    293624 (Irf7)
   05164 Influenza A
    293624 (Irf7)
   05162 Measles
    293624 (Irf7)
   05168 Herpes simplex virus 1 infection
    293624 (Irf7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    293624 (Irf7)
   05169 Epstein-Barr virus infection
    293624 (Irf7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    293624 (Irf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    293624 (Irf7)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    293624 (Irf7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 293624
NCBI-ProteinID: NP_001028863
RGD: 1307828
Ensembl: ENSRNOG00000017414
UniProt: Q3SWU2
Position
1
AA seq 455 aa
MAEVRGVQRVLFGDWLLGEVSSGRYEGLQWLNEAHTVFRVPWKHFSRRDLDEADAQIFKA
WAVARGRWPPSGVNLPPPEAEAAERRGWKTNFRCALRSTGRFILRQDNSGDPADPHKVYE
LSPELGSTTGPALENREEVTLSSALPTQGMSLGSFLARGNAGLQTPSPLLSGDAGDLLLQ
VLQYSHLLDSESRADSVPPQASGQEQEHLPEEPHAAWQMEATSSPRLQHPVLMTERNLGS
LDVTIMYKGRTVLQAMVGHPRCVFLYSPVGSAIRTSEPQPVIFPSPAELPDQKQLHYTET
LLQHVSPGLQLELRGPSLWALRMGKCKVYWEVGSPMGSTNPSTPAQLLERNCHTPIFDFS
TFFRELEEFRARRRQGSPHYTIYLGFGQDLSAGRPKEKSLILVKLEPWLCKTHLEGVQRE
GVSSLDSSSLGLCLSSTNSLYDDIEHFLMDLGQWA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggccgaagtgaggggggtccagcgagtgctgttcggagactggctcttgggtgaggtc
agtagtggccggtacgaggggctgcagtggctgaatgaggctcacacagtcttccgtgtg
ccctggaagcatttcagccgtagggatctggatgaagctgatgcacagatcttcaaggcc
tgggctgtggcccgagggaggtggccacctagtggagttaacttaccacccccagaggct
gaggctgctgagcgaagaggctggaagaccaacttccgatgtgcactccgcagcacaggg
cgctttatcttgcgtcaagacaactcaggggaccctgctgatccgcacaaggtgtatgaa
cttagcccggagcttggatctacaactggcccagctctggagaacagggaagaagtgacc
ctcagcagtgccctacccacacagggtatgtccctaggatcattcctggcaagaggaaat
gctgggttgcaaaccccaagccctctgctttctggtgatgctggggacctcttgcttcag
gttctgcaatacagccacctactggactctgagtctagggcggactcagtcccaccacag
gcttctggccaggagcaagaacaccttcctgaggagccccatgcagcatggcagatggaa
gctacctccagccccaggcttcaacacccagttctgatgactgagcgcaaccttgggtcc
ctggatgtgaccatcatgtacaagggccgcacagtgctacaggcaatggtggggcacccc
agatgcgtgttcctgtatagccccgtgggctcagcaataagaacttcagagccccagccg
gtgatttttccgagccccgctgagctcccagatcagaagcagctgcactacacagagact
ctcctacagcatgtgtctccaggccttcagctggagcttcgggggccatcactatgggcc
ctgcgaatgggcaagtgcaaggtgtactgggaggtgggcagccctatgggctccaccaac
ccctccaccccagcccagctgctggagcgcaactgccatactcccatctttgacttcagc
actttcttccgagaactggaggagttccgggcccggaggcgacaaggatcaccacattac
accatctacctgggttttgggcaagacttgtcagcagggaggcccaaggagaagagcctg
atcctggtgaagctggagccatggctgtgcaagacacatctggaaggcgtgcagcgtgag
ggtgtgtcctctctggacagcagcagtcttggcctgtgcttgtctagcaccaatagtctc
tacgatgacattgaacacttcctcatggacctgggtcagtgggcttga

DBGET integrated database retrieval system