KEGG   Rattus norvegicus (rat): 293649
Entry
293649            CDS       T01003                                 

Gene name
Lrp5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5 precursor
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05200  Pathways in cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    293649 (Lrp5)
   04150 mTOR signaling pathway
    293649 (Lrp5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    293649 (Lrp5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293649 (Lrp5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    293649 (Lrp5)
   05226 Gastric cancer
    293649 (Lrp5)
   05224 Breast cancer
    293649 (Lrp5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    293649 (Lrp5)
   05022 Pathways of neurodegeneration - multiple diseases
    293649 (Lrp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    293649 (Lrp5)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    293649 (Lrp5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD Gp3-like
Other DBs
NCBI-GeneID: 293649
NCBI-ProteinID: NP_001099791
RGD: 1309329
Ensembl: ENSRNOG00000015911
UniProt: B2RYI1
Position
1
AA seq 1600 aa
METAPTRAPPPPPQPLLLLLALCCSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIVAS
GLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPDGLACDWVGK
KLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAG
MDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHP
FALTLSGDTLYWTDWQTRSIHACNKWTGEKRKEILSALYSPMDIQVLSQERQPPFHTPCE
EGNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTP
DFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGE
NPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRQTL
LEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV
GTNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISL
ETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYP
EGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEW
GGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMV
IADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQ
DGLNDCVHSNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMI
PDDQLSPDLILPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPSMLTSPSQSL
SPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDRPRAIAVNAERGY
MYFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCD
LSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTG
IHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS
PDQFACATGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDAV
CLPNQFRCASGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDVPAHSSAIGPVIGIIL
SLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGTPHVPLNFIAPGGSQHGPFPGIPCSK
SMMSSVSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDM
FYSSNIPSTARPYRPYIIRGMAPPTTPCSTDVCDSDYSTSRWKTSKYYLDLNSDSDPYPP
PPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
NT seq 4803 nt   +upstreamnt  +downstreamnt
atggaaacggcgccgacccgggcccctccgccgccgccgcagccgctgttgctgctgctg
gcgctgtgctgcagcctagtccccgctgcggcctcaccactcctgttgtttgccaaccgc
cgggatgtacgactagtggatgctggtggagtgaagctggagtccaccattgtggccagt
ggtctggaggacgcagctgctgtagacttccagttctccaagggtgctgtgtactggaca
gatgtgagcgaggaggccatcaaacagacctacctgaaccagactggagctgctgcacag
aacattgtcatctctggccttgtatcacctgatggcctggcctgtgactgggttggcaag
aagctgtactggacagactcagagaccaaccgcatcgaggtggccaacctcaatgggacg
tcccgtaaggttctcttctggcaggacctggaccagccaagggccattgccctggatcct
gcacatgggtacatgtactggactgactggggggaagcaccccggatcgagcgggcaggg
atggatggcagtacccggaagatcattgtagactccgacatttactggcccaatgggctg
accattgatctggaggagcagaagctgtactgggctgatgccaaactcagcttcatccac
cgtgccaacctggacggctccttccggcagaaggtggtggagggcagcctcactcacccc
tttgccctgacactctctggggacacactctactggacagactggcagacccgttctatc
cacgcctgcaacaagtggacaggggagaaaaggaaggagatcctcagtgctctgtattca
cccatggacattcaggtgctgagccaggagcggcagcctcccttccacacgccatgtgag
gaaggcaacggcggctgctcccacctgtgcctgctgtccccgagggagcccttctactcc
tgcgcctgccctactggtgtacagttgcaggacaatggcaagacgtgtaaggcaggggct
gaggaagtgctgctgctggcccggaggacagacctgagaaggatctctctggacacccct
gacttcacagacatagtgctgcaagtgggcgacattcggcatgccatcgccatcgactat
gacccactggagggctacgtgtactggacagatgacgaggtgcgggctatccgcagggcg
tacctggatggctcaggtgcgcagacccttgtgaacaccgagatcaatgatcccgatggc
attgccgtggactgggtcgcccggaacctctactggacagatacaggcactgacagaatt
gaggtgactcgcctcaacggcacctcccgaaagatcctggtgtccgaggacctggacgaa
cctcgcgccattgtgttgcaccctgtgatgggcctcatgtactggacagactggggagag
aaccccaaaatcgaatgtgccaacctagatgggcgagatcggcatgtcctggtgaacacc
tcccttgggtggcccaatggactggccctggacctgcaggagggcaagctgtactggggg
gatgccaaaactgataaaattgaggtgatcaacatagacgggacaaagcggcagaccctg
ctagaggacaagctcccgcacatttttgggttcactctgcttggggacttcatctactgg
acagattggcagcgacgcagtattgagagggtacacaaggtcaaggccagccgggatgtc
atcatcgatcaactccccgacctgatgggactcaaagcagtgaacgtggccaaggttgtc
ggaaccaacccgtgtgcggatggaaatggagggtgcagccatctgtgcttcttcacccca
cacgccaccaagtgcggttgccccataggcctggagctgctgagtgacatgaagacctgc
ataatccctgaagccttcctggtgttcaccagcagagccaccatccacaggatctccctg
gagactaacaacaatgacgtggccatcccgctcaccggtgtcaaggaggcctctgcactg
gactttgatgtgtccaacaaccacatctactggactgatgtcagcctcaagactatcagc
cgagccttcatgaatgggagctcagtggagcacgtgattgagtttggcctcgactaccct
gaaggaatggccgtggattggatgggcaagaacctctattgggctgacacggggaccaac
aggattgaggtggcccgactggatgggcagttccggcaggtgctggtgtggagagacctt
gacaaccccaggtcgctggctctggatcctactaaaggctacatctactggaccgagtgg
ggaggcaagccaaggatcgtgcgggccttcatggatgggaccaattgtatgacactggta
gacaaggtgggccgggccaatgacctcaccattgattacgccgaccagcgactgtactgg
actgacctggacaccaacatgattgagtcctccaacatgctgggtcaggagcgcatggtg
atagctgatgatctgccctacccctttggcctgactcaatatagcgattacatctactgg
accgactggaacctgcatagcattgaacgggccgacaagaccagcgggcggaaccgtacc
ctcatccagggtcacctggacttcgtcatggacatcctggtgtttcactcctcccgtcag
gatggcctcaacgactgcgtgcacagcaatggccagtgtgggcagctgtgcctcgccatc
cccggaggccaccgctgcggctgtgcttcccactacacgctggaccccagcagccgcaac
tgcagcccgccctccaccttcttgctgttcagccagaaatttgccatcagccggatgatc
cccgatgaccagctcagtccggaccttatcctacccctacacgggctgaggaatgtcaaa
gccatcaactacgacccgctggacaagttcatctactgggtggatgggcgtcagaacatc
aagagggccaaggacgacggtacccagccctccatgctgacctctcccagccaaagcctg
agcccagaccgacagccacatgacctcagcattgacatctacagccggacactgttctgg
acctgtgaggccaccaacaccatcaatgtccaccggctggatggggatgccatgggagtg
gtgcttcgaggggaccgtgacagaccaagggccattgctgtcaatgctgagcgagggtac
atgtactttaccaacatgcaggaccatgctgccaagattgagcgagcctccctggatggc
acggagcgtgaggttctcttcaccaccggccttatccgtcctgtggcccttgtggtggac
aatgccctgggcaagctcttctgggtggatgcagacctaaagcgcattgaaagctgcgac
ctctcaggggccaaccgcctgaccctggaagatgccaacatcgtgcagccagtaggtctg
acggtgctggggaggcacctctactggatcgaccgccagcagcagatgattgagcgtgtg
gagaagaccactggggacaagaggactagggttcagggccgtgtcacccacctgacgggc
atccatgctgtggaggaagtcagcctggaggagttctcagcccatccttgtgcccgagac
aatggcggctgctcccatatctgcatcgccaagggtgatgggacaccgcgctgctcatgc
ccagtccacctcgtgctcctgcagaacctgctgacttgtggtgagcctcctacctgctcc
cctgatcagtttgcatgtgccactggtgagattgactgcatccctggagcctggcgctgt
gacggcttccctgagtgtgctgaccagagtgatgaggaaggctgcccagtgtgctctgcc
tctcagttcccctgtgctcgaggccagtgcgtggacctgcgtttacgctgcgatgctgtc
tgtctccccaatcagttccggtgcgccagtggccagtgcgtcctcatcaagcagcagtgc
gattccttccccgactgtgctgatggatctgatgagctcatgtgtgaaatcaacaagcca
ccttctgatgacgtaccagcccacagcagcgccattgggcctgtcattggcatcatcctg
tccctcttcgtcatgggcggggtctactttgtctgccagcgtgtgatgtgccagcgttac
acaggggccagtggtccctttccccacgagtatgttggtggaacccctcatgtgcctctc
aacttcatagccccaggtggctcacagcacggtcccttcccaggcatcccgtgcagcaag
tccatgatgagttctgtgagcctggtgggggggcggggcagcgtgcccctctatgaccgg
aatcacgtcaccggggcctcatccagcagttcatccagcacaaaggccacactctatcca
ccgatcctgaacccaccaccgtccccggccacagacccctccctgtacaacatggacatg
ttttattcttcaaacatcccatccactgccagaccatacaggccctacatcattcgaggt
atggcacccccaacaacaccttgcagcacagacgtgtgtgacagcgactacagcaccagt
cgctggaagaccagcaagtactacctggacttgaattcggactcagacccctacccgccc
ccgcccactccccacagccagtacctgtctgcagaggatagctgtccaccctctcctgtc
actgagagaagctactgccacctcttcccaccccctccatccccctgcacggactcgtcc
tga

KEGG   Rattus norvegicus (rat): 312781
Entry
312781            CDS       T01003                                 

Gene name
Lrp6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05200  Pathways in cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    312781 (Lrp6)
   04150 mTOR signaling pathway
    312781 (Lrp6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    312781 (Lrp6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    312781 (Lrp6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    312781 (Lrp6)
   05226 Gastric cancer
    312781 (Lrp6)
   05224 Breast cancer
    312781 (Lrp6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    312781 (Lrp6)
   05022 Pathways of neurodegeneration - multiple diseases
    312781 (Lrp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    312781 (Lrp6)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    312781 (Lrp6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Other DBs
NCBI-GeneID: 312781
NCBI-ProteinID: NP_001101362
RGD: 1304749
Ensembl: ENSRNOG00000006338
UniProt: D3ZUH9
Position
4
AA seq 1234 aa
MYWTDWGEVPKIERAGMDGSSRFVIINTEIYWPNGLTLDYEERKLYWADAKLNFIHKSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLESGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYVYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMAGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQ
LPDLMGLKATSVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGGQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVIDVTRLDGRSVGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDS
KLSRLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQQFTCFTGDIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCVGKHKKCDHNVDC
SDRSDELDCYFEPTTILQAVQLPALCTAHYTLQH
NT seq 3705 nt   +upstreamnt  +downstreamnt
atgtactggacagactggggagaagtgccaaagatagaacgtgctggaatggatggttca
agtcgctttgttataataaacactgagatttactggccaaatggactgactctggattat
gaggagcggaagctttattgggcagatgcaaaacttaatttcatccataaatcaaacctg
gacggaacaaatcgacaggcagtggttaaaggttcccttccacatccttttgccttgacg
ttatttgaggacacattgtactggactgactggaatacacactctattttggcttgcaac
aagtatactggcgagggtctgcgtgaaattcattctaacatcttctctcccatggatata
catgctttcagccaacagaggcagccaaatgctacaaatccatgtggaattgataatggt
ggttgttcccatttgtgtttgatgtctccagtcaagcctttttatcagtgtgcttgtcca
actggggtcaagcttctggagagtggaaaaacctgcaaagatggtgccactgaactattg
ctgttagcccgacggacagacttgaggcgcatctctttggatacaccagatttcaccgac
attgtcctacagttagaagacatccgacatgccattgccatagactacgaccccgtggaa
ggctacgtctactggacggacgatgaagtacgggccatccgtcgctccttcattgatgga
tctggcagtcagtttgtggtcacggcccagattgcccatcctgatggtattgctgttgac
tgggtggcaagaaacctgtactggacagacactggcactgatcggatagaagtgacaagg
ctcaatgggaccatgaggaagatcctgatttcagaggacttagaggagccccgggctatt
gtgttagatcccatggctgggtacatgtactggacggactggggagaaatcccaaaaatc
gagcgagctgctctggacggatctgaccgagtagttcttgttaacacttcccttggttgg
ccaaatggcttagccctggattatgatgaaggcacaatatactggggagatgccaaaaca
gacaaaattgaggttatgaatactgatggcactgggaggcgagtgctggtggaagacaag
atccctcacatatttgggtttaccttgctgggcgactatgtttactggactgactggcag
aggcggagcatcgagagagtgcacaagcggagtgcagagagggaggtcataatagaccag
ctgccagacctcatgggactgaaggccacaagcgttcacagagtcattggttctaacccc
tgtgctgaggagaatggaggatgtagccatctttgcctctacaggcctcagggacttcga
tgtgcctgtcccattggctttgagctcattagtgacatgaagacatgcattgttcctgag
gctttccttctgttctcacggagagcagatataagacgcatctctttggaaacaaacaac
aacaatgtggccattcctctcacgggtgtcaaagaagcttctgctttggattttgatgtc
acagacaacagaatttactggaccgatatatccctgaagactattagcagagcttttatg
aatggcagtgcactggaacatgtggtagagttcggcttagattacccagaaggcatggca
gtggactggcttgggaagaacttatactgggcagacacaggaacaaatcgcattgaggtg
tcaaagttggatggacagcaccgacaggttttggtatggaaagaccttgacagtccccga
gctctggcattggatcctgctgaaggatttatgtattggactgagtggggagggaagcct
aagattgacagagcggctatggatggaagtgaacgcactacattagttccaaatgtgggt
cgagcaaatggccttaccatcgactatgctaagaggcggctttactggacagacctggac
actaacttaatagaatcttcaaatatgctcggactcaaccgtgaagttatagcagatgac
ttgcctcatccttttggcttaactcagtaccaagattacatctactggacagactggagc
cgacgcagcattgaacgtgccaacaaaaccagtggccaaaaccgcaccatcatccagggc
catttggattatgtgatggacatcctagtctttcactcttcccggcaggcagggtggaat
gaatgtgcctccagcaacgggcactgctcccacctttgcttggctgtgcctgttggaggt
tttgtgtgtggatgccctgcccactactccctgaatgctgacaacaggacctgtagtgct
cctaccaccttcctgctcttcagtcagaagagcgccatcaaccgcatggtgattgatgaa
caacagagtcctgacatcatccttcctatccacagccttcggaacgtccgggccattgat
tatgaccctttggacaagcagctctactggattgactctcgacaaaacatgatacgaaag
gcacaagaagatggtggccagggttttactgtagttgtaagctcggttccaaatcagaac
cttgaaatacagccctatgatctcagcattgatatttatagccgttacatctattggacc
tgtgaagctaccaatgtcattgatgtgacgagattagatggtcgatcagttggagtggtc
ctaaaaggcgagcaagacagacctcgagccattgtggtaaaccctgagaaagggtatatg
tattttaccaatcttcaggaaagatctcccaaaattgaacgggctgccttggatggaaca
gaacgggaggttctctttttcagtggcctgagtaagcccgtcgctttggctctcgacagc
aagctgagcaggctcttctgggctgactccgacctccggcgaattgagagcagcgacctc
tcaggtgccaacaggatcgtgctagaggactctaatatattgcagcctgtgggtctgacc
gtgtttgagaactggctctactggattgataagcagcaacagatgattgaaaaaattgac
atgactggtcgcgaaggcagaaccaaggtccaggctcggattgctcagctcagtgacatc
catgcagtgaaggagctgaaccttcaggaatacagacagcacccgtgtgcccaggataat
ggtggctgttcacatatttgccttgtaaaaggagatggtaccacaagatgctcctgtccc
atgcatttagttctgcttcaggatgagctgtcctgtggagagcctccaacatgttctcct
cagcagtttacgtgtttcactggggacattgactgcatccctgtggcctggcggtgtgat
gggtttactgaatgtgaagaccacagtgatgagctcaactgtcctgtgtgctcggagtct
cagttccagtgtgccagcgggcagtgcattgacggcgcccttcgatgcaatggtgacgcg
aactgccaggataaatcggatgagaagaactgtgaagtgctttgtctaattgatcagttc
cgctgtgccaatggtcagtgcgttggaaaacacaagaaatgcgaccacaatgtggactgc
agtgacagatctgatgaactggactgctattttgaacccaccaccatcctacaggccgta
cagctaccggcactttgcaccgcccactacaccctgcagcactga

DBGET integrated database retrieval system