KEGG   Rattus norvegicus (rat): 294090
Entry
294090            CDS       T01003                                 

Gene name
Ifit1bl
Definition
(RefSeq) interferon-induced protein with tetratricopeptide repeats 1 isoform X2
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    294090 (Ifit1bl)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_8 TPR_19 TPR_11 TPR_14 TPR_7 TPR_10 TPR_MalT ANAPC3 TPR_15 TPR_16 TPR_9 TPR_17 NARP1 BTAD SNAP TPR_20 DUF6018 DUF1910 DUF5402
Other DBs
NCBI-GeneID: 294090
NCBI-ProteinID: XP_017445832
RGD: 1304872
Ensembl: ENSRNOG00000036603
Vega: OTTRNOG00000000115
Position
1
AA seq 433 aa
MPDLEAKILETEFLDTNYNMGMHNLMAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSL
VTWGNCAWVHYHRGSLAEAQIYLDKVENVCREFASPFRYRMECAEIDCEEGWALLKCGGS
NCTRAMACFAKALQEEPENPEYNAGYAITAFRMDFSNEISLEPLRKAVRLNPEDPHLKVL
LALKLQDLGKQDEAEKHIEEALPKIPSRNNIFGYVAKFYRRKGCVEEALEFLERALKTKP
SSVYLHFQIGLCHKSRVFQIKEATNMHPKGKDRERADQSIRSAIYYFEKTLDLKPTYERA
YIDLAEMYAESKQFEEAEEAFQKVLSMLSNLEVHMQQEIHFRYGKFQQFHMKSENIAITH
YLKGLKIEVTSIFRDKLLKALQKLAERRMQQNVHVLESLSLLGFVYRLKGDTRKAMSCYE
KALRLTEELNPEF
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcctgatttggaagcaaaaatcttggagactgagttccttgataccaactacaacatg
ggaatgcacaacctcatggcctacgtgagacacctgaaaggtgagcaggaggaagccctg
cagagcttgaaagaggctgaagccttgatcgagggagagcagttgggcaagagaagcctg
gtgacctggggcaactgtgcctgggtgcattaccacaggggcagcttggcagaagcccag
atctacctggacaaggtggagaatgtttgcagggagttcgcaagtcccttccgctacagg
atggagtgtgctgagatagactgtgaggaaggctgggccttgctgaagtgtggaggaagt
aattgtacacgagccatggcctgctttgcaaaggctctgcaggaggagccagaaaaccct
gagtacaacgctggctatgcaatcacagcctttcgcatggatttctctaatgagatttct
ctagaacctctaaggaaggctgtcagattaaatccagaagatccacaccttaaagttctc
cttgctctaaagcttcaggatttaggaaaacaagatgaagcagaaaaacacattgaagaa
gctctgcccaaaataccctcccgaaacaatatctttggatatgtagccaaattttaccga
agaaaaggttgtgtggaagaagctctcgagttcctcgaaagagccttgaagacaaaacct
tcctccgtctacttgcatttccagattggcctttgccataagagccgagtgtttcaaata
aaggaagctacaaacatgcaccctaaggggaaggatagagaaagagcagaccaatccatt
cgttctgctatatattattttgaaaagactttagatctgaaacccacatatgagagagct
tatattgatctggctgaaatgtatgcagaatctaaacaatttgaagaggcagaggaagct
tttcagaaagtgttgagcatgttgagtaacttggaagttcatatgcagcaagagattcat
ttccgctacggcaagttccaacaattccatatgaagtcagaaaatatagccatcacccat
tacttaaaaggcctgaaaatagaggtgacttctatattcagggataaacttctcaaggct
ttgcagaagctggctgaaagacgcatgcagcagaatgttcatgtcctggaaagtttgagc
ctccttgggtttgtctacagactgaaaggggacacacgtaaagccatgtcatgctatgag
aaggccctgaggctcacagaagaattgaaccccgagttttga

KEGG   Rattus norvegicus (rat): 56824
Entry
56824             CDS       T01003                                 

Gene name
Ifit1
Definition
(RefSeq) interferon-induced protein with tetratricopeptide repeats 1-like protein
  KO
K14217  interferon-induced protein with tetratricopeptide repeats 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56824 (Ifit1)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_12 TPR_14 TPR_19 TPR_MalT ANAPC3 TPR_15 TPR_16 SHNi-TPR ANAPC5
Other DBs
NCBI-GeneID: 56824
NCBI-ProteinID: NP_064481
RGD: 620599
Ensembl: ENSRNOG00000019050
UniProt: Q9JJT1
Position
1
AA seq 463 aa
MGENAGGDQVMENLLQLRCHFTWGLLFEKNDIPDLEVRISEQVQFLDIKNSLGMHNLQAY
VRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQIYLDKVEN
VCREFSSPFRYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPEYNAGYAV
VAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLGEQDEAETHIEEALSSTSC
QSYVFRYAAKYFRRKGDINEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKTSGNRQ
ARRQENIQELAHQAICEFQETLNLRPTFEMAYVCMAEMQAEIGQYEEAEGNFQEALNLNN
LVAHIEQDIHFRYGRSQQFHKKSEDKAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVR
QNVRLVESTSLLGLVFKLKGQEMKALLYYEKALRLSGEMNPAF
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggagagaatgctggtggtgaccaggtcatggagaatctgcttcagctgagatgtcac
ttcacatggggcctgctcttcgaaaaaaatgacatacctgatttggaagtgaggatctca
gagcaggtccagttccttgacatcaagaactcactggggatgcacaacctccaggcctac
gtgagacacctgaaaggtgagcaggaggaagccctgcagagcttgaaagaggctgaagcc
ttgatcgagggagagcagttgggcaagagaagcctggtgacctggggcaactgtgcctgg
gtgcattaccacaggggcagcttggcagaagcccagatctacctggacaaggtggagaat
gtttgcagggaattctcaagtcccttccgctacaggatggagtgtgctgagatagactgt
gaggaaggctgggccttgctgaagtgtggaggaagtaactatatgcgagccatggcctgc
tttgcaaaggctctgcaggtggacccagaaaaccctgagtacaatgctggctatgcagtt
gtggcctatcgccaagatttcgatgacaaccatgtttctctagaacctctaaggaaggct
gtcaggttaaatccagaagatccacaccttaaagttctccttgctctaaagcttcaggat
ttaggggaacaagatgaagcagaaacacacattgaagaagccctcagcagcacatcttgc
caaagctatgtctttcgctacgcagccaaatatttccgccggaaaggtgacataaacgaa
gctcttcatcttctacacagggccttgcagacgtcaccttcctctggctacctacattac
caaaaagggctctgttacaagcaacagatgatccaactgaagacatctggaaacaggcag
gccagaaggcaggagaatatacaggaattggcacatcaggccatttgtgaatttcaagag
actttgaatctgaggcccacatttgagatggcttacgtttgcatggctgaaatgcaggca
gaaattggccaatatgaagaagcagagggaaatttccaggaggccctgaacctcaacaac
cttgtagcccacatagagcaggatattcatttccgctacggccgttcccaacaatttcat
aagaagtcagaagacaaggcaatcactcactacttaaaaggtctaaaactagaagagaag
tcctttgcctggaggaaactactcacagctttggagaaagtggctgaaagacgtgttcgc
cagaatgtccggcttgtggagagcaccagccttcttggactggtcttcaaactgaaaggg
caggagatgaaggccctgctttactatgagaaggccctgaggctctctggggaaatgaac
cctgcattttga

DBGET integrated database retrieval system