KEGG   Rattus norvegicus (rat): 296501
Entry
296501            CDS       T01003                                 

Symbol
Hat1
Name
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    296501 (Hat1)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    296501 (Hat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    296501 (Hat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     296501 (Hat1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    296501 (Hat1)
   HAT complexes
    HATB complex
     296501 (Hat1)
SSDB
Motif
Pfam: Hat1_N Acetyltransf_7 Myb_DNA-bind_4 Acetyltransf_10 DUF5344 Acetyltransf_1
Other DBs
NCBI-GeneID: 296501
NCBI-ProteinID: NP_001009657
RGD: 1305716
Ensembl: ENSRNOG00000001524
UniProt: Q5M939
Position
3
AA seq 419 aa
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEADFKPFGTLLHTYSVPSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYIASSSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SRERLLQGFNEDMAIQAQQKFKINKQHARRVYEILRLLVTDMSDAEQCRSYRLDIKRRLI
SPYKKKQTDLAKMRKCLRPEELTNQMNQIEISVQHEQLEEQFQELVEDYRRVIERLAQE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggggtttggtgcaatggagaaatttctagtggaatataagagtgcggtggagaag
aaactggctgagtacaagtgtaacaccaacacagcaatcgagctgaaactggttcgtttt
cctgaagatcttgagaatgacattagaactttctttcctgaatatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggcctgaagatcttgttgtactatattgct
ggtagcctgtcaactatgttccgtgttgaatatgcatctaaagttgatgagaactttgat
tgtgtggaggcagatgacgttgaaggcaaaatcagacaaatcattccacctgggttttgc
acaaacacaaatgattttctttccttgctggaaaaggaagctgatttcaagccatttgga
accctcctccatacatactcagttcctagtccaacaggaggagaaaactttacttttcag
atatacaaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgatactgactccatttcaaggtcagggccatggtgctcaacttcttgaaacagtt
catagatactacattgcatcttcttcagttcttgatattacagcggaagatccatccaaa
agctatgtgaaactaagagactttgtacttgtgaaactttgtcaagatttgccctgtttc
tcccgggaaagattactgcaaggattcaatgaagatatggcgatacaggcacagcagaag
ttcaaaataaataagcaacatgctagacgggtttatgaaattctccgactgctggtgact
gacatgagtgacgcggagcagtgcagaagctacagactggatattaaaaggagactaatc
agcccttacaagaaaaagcagacagatcttgccaagatgaggaaatgcctgagaccagaa
gagctgacgaatcagatgaaccagatagagataagtgtgcagcacgagcagctggaggag
cagtttcaggagctggtggaggactaccggcgtgtcattgagcgccttgctcaagagtga

DBGET integrated database retrieval system