KEGG   Rattus norvegicus (rat): 296545
Entry
296545            CDS       T01003                                 

Symbol
C8g
Name
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    296545 (C8g)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    296545 (C8g)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    296545 (C8g)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    296545 (C8g)
  09164 Neurodegenerative disease
   05020 Prion disease
    296545 (C8g)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 296545
NCBI-ProteinID: NP_001100025
RGD: 1309074
Ensembl: ENSRNOG00000028701
UniProt: D3ZPI8
Position
3
AA seq 164 aa
MLQGPERHFAGTWLLVAVGSACRFLQEQGHRAEATTLHIAPQGAAMAASTFRKLDGICWQ
VRQLYGITGVPGRFLLQAPRARGPVHVVVAETDYQSFAILYLEQARRLSVKLYTRTLPVS
DSALNAFEERVRGANLTEDQIFFFPKYGFCETADQFHILNEMPK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgctccagggcccagagagacattttgcagggacatggctccttgtggctgtgggctct
gcatgccgctttcttcaggagcagggacaccgggctgaggccactacattgcacatagct
ccccagggtgcagctatggctgccagcaccttccgaaagctagacgggatctgctggcag
gtgcgccaactctatggaatcacaggggtccctggccgcttcttgctccaagctccacgg
gcccgtgggccagtacatgtggttgttgctgagaccgactaccagagctttgccatcctg
tatctggagcaggcgaggaggctgtctgtgaaactatacacccgcacactgcctgtgagt
gattctgccctgaatgcgtttgaggagcgagtcaggggagccaacctgacagaagaccag
atctttttctttcccaagtatggtttctgtgagactgcagaccaattccacatcctgaat
gagatgccgaagtga

KEGG   Rattus norvegicus (rat): 298288
Entry
298288            CDS       T01003                                 

Symbol
C8a
Name
(RefSeq) complement component C8 alpha chain precursor
  KO
K03997  complement component 8 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    298288 (C8a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    298288 (C8a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    298288 (C8a)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    298288 (C8a)
  09164 Neurodegenerative disease
   05020 Prion disease
    298288 (C8a)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin Cofilin_ADF
Other DBs
NCBI-GeneID: 298288
NCBI-ProteinID: NP_001100140
RGD: 1308355
Ensembl: ENSRNOG00000007697
UniProt: D3ZWD6
Position
5
AA seq 587 aa
MFTVAFFGLSLMAWHSGVTAQEKVNQRVTRAVTPGAVACQLSDWSEWTDCFPCQNEKYRY
RSLLQPSKFGGTICSGDIWDKANCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDQD
CLDGSDEDNCDDARVIEDDCRQYEPIPGSERAALGYNILTQEEGQSVYDAKYYGGQCETV
YNGDWRRLQYDPTCERLYYGEDEKYFRKPYNFLKYHFEALADTLISSEFYDDANDLFSKI
QRDKSQSNSVTFGISPAKSPITLDASVSWSDESSFMKELSKYNEKKYSFMRVSTKVQTAH
FKMRRHNIVLDEGMMESLMELPEQFNYGMYSKFINDYGTHYITSGTMGGIYEYVLVLDKE
KMRIHGITVEDVKKCIGGGVGLQFGEKIIGEGDLSGESCVMTGDGNQDKRKKDLAVEDII
SRVQGGSSRWSTGLAHNSSAITYRSWGRSLKYNPVVIDFEMQPIYQLLQHTNLGPLETKR
RNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCSCQCSMGRQGPACESMVLEAMEGAK
ADGRWSCWSSWSECRGGSRERRRQCNNPAPQNGGAPCLGKSLQTQAC
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtttacagttgctttctttggtttgtctctgatggcatggcactccggggtaactgca
caagagaaggtgaaccagcgggtcacccgagctgtgaccccaggagcggttgcctgtcag
ttgagtgactggtcagaatggacagattgttttccatgtcagaacgaaaagtaccgatac
cggagcctcttgcagccaagcaagtttggaggaaccatctgcagtggtgatatatgggat
aaggccaactgtgacagccccacaccttgtctaaggcaagcacagtgtggacaggatttc
cagtgtagagagacaggtcgctgcctgaaacgccacctggtatgcaatggagatcaggac
tgccttgatggctctgatgaggataactgtgatgatgccagggtcattgaagatgattgc
cgtcagtatgaaccaatcccaggatcagaaagggcagccttggggtacaatatcctgact
caagaagaaggccagagtgtgtatgatgctaagtattatggaggccagtgtgaaactgtg
tacaatggagactggagaaggctgcagtacgaccccacctgtgagcgcctctactatggg
gaggatgagaaatacttccggaagccctacaacttccttaagtaccactttgaagccctg
gcggatactttaatctcttcagagttttatgatgatgcaaatgaccttttttctaagata
cagagggacaaatcccagtcaaatagtgtaacatttggcataagcccagcaaaaagtcct
atcacactagacgcgtccgtatcctggtccgatgaatcttccttcatgaaggagttaagc
aagtataatgagaagaaatatagcttcatgagagtgtccacgaaggtacagacggcacat
tttaagatgaggaggcacaatattgtgctggatgaagggatgatggagtcactgatggag
ctcccagagcagtttaactacggcatgtactccaagttcatcaatgactatggcacccac
tacatcacctctggaaccatgggtggcatttacgaatatgttctggtgcttgacaaagag
aaaatgagaattcatggcattactgtggaagatgtcaaaaaatgcatcggaggtggcgtt
ggcctgcagtttggagagaaaataattggtgaaggagatttatcaggagagtcttgtgtc
atgactggagatggcaaccaggacaaaaggaagaaggacttggcagtggaggacatcatt
tctcgggtacaaggtggaagttctcgctggagcactggcttggcacacaacagcagtgct
attacataccggtcttgggggagatcattaaagtataaccctgttgttatcgattttgag
atgcagcccatctatcagctactgcagcacacaaacctggggcctctggagactaaacgt
cggaacctgcgcagggctttggaccagtacctgatggaatttaatgcctgccgctgtggg
ccctgcttcaacaatggggtacccatactcgagggcaccagctgctcgtgtcaatgtagc
atgggccggcagggccctgcctgtgagagcatggtattggaagcgatggagggagccaaa
gctgatggtcgttggagctgctggagttcctggtcagagtgtagaggagggtcccgggag
aggaggagacagtgcaacaatccagcaccccagaatggaggtgccccatgcctagggaag
agcctgcagacccaggcctgctga

KEGG   Rattus norvegicus (rat): 313421
Entry
313421            CDS       T01003                                 

Symbol
C8b
Name
(RefSeq) complement component C8 beta chain precursor
  KO
K03998  complement component 8 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05020  Prion disease
rno05146  Amoebiasis
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    313421 (C8b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    313421 (C8b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    313421 (C8b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    313421 (C8b)
  09164 Neurodegenerative disease
   05020 Prion disease
    313421 (C8b)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 313421
NCBI-ProteinID: NP_001178688
RGD: 2239
Ensembl: ENSRNOG00000007639
UniProt: P55314
Position
5
AA seq 589 aa
MKTGAQVWRALAKSCLLCAALGCLHLPGARGEKPDFFETNAVNGSLVRSRPVRSVDVTPA
PTDCQLSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDFSDKEVEDCVTNRACRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCSQDMEQYWAIGNLASGINL
FTNTFEGPVLDHRYYAGACSPHYILNTNFRKPYNVESYTPQTQGKYEFALTEYESYFDFE
HNVTEKATSKSSFKFGFKLDGLVEFGVRKESNEGRHYISRTKRFSHTKSKFLHARSVLEV
AHYKLKSRQLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMN
KDAMERGDYTLDHVSACAGGGFQIGGNVYKVYLKLGVSEKKCSDILNEIKDRNKRRTMVE
DLVVLVRGGTSEYITSLAYKDLPTAELMKEWGDAVQYNPAIIKLKAEPLYELVTATDFAY
SSTVKQNMKKALEEFQMEVSSCRCAPCRNNGVPILKESRCECICPAGFQGVACEVTNRKD
IPIDGKWSCWSDWSPCSGGRKTRQRQCNNPAPQRGGSPCSGPASETLDC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccaggtttggagggcactggcaaagtcatgtcttctttgtgctgcc
cttggatgtctccatctccctggtgcaagaggtgagaagccagatttctttgagacaaat
gcagtcaatggaagccttgttaggagcagaccagtacggagtgtggatgtcaccccagca
cctactgactgtcaactatccacctggtcctcctggactgcatgtgacccctgtcagaag
aaaaggtacagacacacttacttgctccggccctctcagttctatggggaactgtgtgac
ttctccgacaaggaagttgaagactgtgttaccaaccgagcctgcagaagtcaagtacga
tgtgaaggctttgtgtgtgcacagacagggaggtgtgtgaatcgcagactcctctgcaat
ggagacaatgactgtggagaccaatcagatgaagccaactgtaggaggatttataaaaaa
tgctcacaggatatggaacagtactgggcaattggcaatctggccagcgggataaatctg
ttcacgaacacttttgagggcccagttctcgatcaccggtattatgctggcgcttgctcc
ccccactacatcctgaacaccaattttaggaagccatacaacgtagagagctacacccca
cagacccaaggcaaatatgaatttgcacttacagaatatgaatcctatttcgattttgaa
cataatgtgacagaaaaagcaaccagcaagtctagtttcaagtttggttttaaactggat
ggcctggttgagtttggagtgagaaaagaaagcaacgagggcagacattacattagcaga
accaaacggttctcccacactaaaagcaagtttctgcacgcgcgctctgtccttgaagtg
gcgcattacaagctgaagtccagacagctcatgctccattacgaattccttcagagggtc
aagagcctgcccctggagtacagctatggagaataccgagatctccttcgtgactttggg
acccatttcatcaccgaagccgtgcttgggggcatctacgagtacacgcttatcatgaac
aaagacgccatggagcgaggagattacactctggaccatgtttcagcctgtgccggagga
ggtttccagattggtggtaacgtctataaagtctacctcaaattgggtgtgtccgaaaag
aaatgcagtgacattctgaatgaaatcaaagacagaaataagagacgcaccatggtagaa
gacttggtagttcttgtgcgaggagggacaagtgagtacatcacctccttggcatacaag
gatctgccaacagcagagctgatgaaggaatggggcgatgctgtgcagtacaacccagcc
atcatcaagctcaaggctgagcccctgtatgaacttgtgacagccacagactttgcgtac
tccagcacagtgaaacagaacatgaagaaggccctagaagaattccagatggaggtcagc
tcctgccgctgtgctccgtgcaggaacaatggagtccccatcctgaaagaatcccgctgt
gagtgcatctgtcctgctggcttccaaggtgtagcctgtgaggtcaccaatcggaaagat
atccccatagatgggaagtggagttgctggtctgactggtctccatgctctggaggacgc
aaaacaagacaaaggcagtgcaacaacccggcacctcagagaggaggcagcccctgctca
ggtcctgcttcagaaacactcgactgttaa

DBGET integrated database retrieval system