KEGG   Rattus norvegicus (rat): 29712
Entry
29712             CDS       T01003                                 

Gene name
Kcnj2
Definition
(RefSeq) inward rectifier potassium channel 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno04924  Renin secretion
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    29712 (Kcnj2)
   04924 Renin secretion
    29712 (Kcnj2)
  09154 Digestive system
   04971 Gastric acid secretion
    29712 (Kcnj2)
  09156 Nervous system
   04725 Cholinergic synapse
    29712 (Kcnj2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    29712 (Kcnj2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   29712 (Kcnj2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans DUF6057
Other DBs
NCBI-GeneID: 29712
NCBI-ProteinID: NP_058992
RGD: 61968
Ensembl: ENSRNOG00000004720
UniProt: Q64273
Position
10
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHCYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEEDSENGVPESTSTDSPPGIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgagaaccaaccgctacagcatcgtctcttcggaggaagacggcatgaag
ctggccaccatggccgtcgccaatggctttgggaatggcaagagtaaagtccatacccga
caacagtgcaggagccgctttgtgaagaaagacgggcattgcaacgttcagtttatcaac
gtgggagagaaaggacagaggtacctggcggacatctttactacctgtgtggacatccgc
tggcggtggatgctggtaatcttctgcctcgcattcgtgctctcctggctgttctttggc
tgtgtgttttggttgatagctctgctccacggggatctggatgcttctaaagagagcaaa
gcgtgtgtgtctgaggtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccatcggctatggtttcaggtgtgttacagacgagtgcccgattgctgttttcatg
gtggtattccagtcaatcgtgggctgcatcatcgacgccttcatcattggtgcagtcatg
gcgaagatggcgaagccaaagaagaggaatgagactctggtcttcagccacaacgctgtg
attgccatgagggacggcaaactctgcttgatgtggagagtgggcaaccttcgcaagagc
caccttgtggaagctcatgtccgggcacagcttctcaaatctaggatcacttcagaaggg
gagtacatccccttggaccagatagacatcaacgttggtttcgatagcggaatcgaccgt
atatttctagtgtccccaatcactattgtccatgaaatagacgaagacagccctttgtat
gacttgagtaagcaggacattgacaatgcagactttgaaatcgttgtcatcctggaaggc
atggtggaggccactgccatgacaacgcaatgccggagttcatatctggccaatgagatt
ctctggggtcaccgctacgagccggtgctctttgaagagaagcattgctataaagtagac
tattcaagattccataagacttacgaagtacctaacactcccctttgtagtgccagagac
ttagcagagaagaaatacatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctaacaagcaaagaggaagaggacagtgagaacggagttccagagagcacaagtacg
gactcacctcctggcatagatctccacaaccaggcgagcgtgcctctagagcccaggcct
ttaaggcgagaatcggagatatga

DBGET integrated database retrieval system