KEGG   Rattus norvegicus (rat): 299188
Entry
299188            CDS       T01003                                 

Gene name
Zfyve1
Definition
(RefSeq) zinc finger FYVE domain-containing protein 1
  KO
K17603  zinc finger FYVE domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    299188 (Zfyve1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    299188 (Zfyve1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    299188 (Zfyve1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    299188 (Zfyve1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    299188 (Zfyve1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     299188 (Zfyve1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    299188 (Zfyve1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    299188 (Zfyve1)
SSDB
Motif
Pfam: FYVE GBP AIG1 zf-B_box IBR DUF429 MMR_HSR1
Other DBs
NCBI-GeneID: 299188
NCBI-ProteinID: NP_001100213
RGD: 1307795
Ensembl: ENSRNOG00000008614
UniProt: D4A3T4
Position
6
AA seq 777 aa
MSAQTSLAEKGLNPGLMCQESYACSGTDEAVFECDECCSLQCLRCEEELHRQERLRNHER
IRLKAGHVPYCDPCKGPNGHSPGVRQRAAVRCQTCKINLCLECQKRTHSGGNKRRHPVTV
YHVSKVQESLEGEEMDEETKRRKMTERVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHL
KVVSIFGNTGDGKSHTLNHTFFHGREVFKTSPAQESCTVGVWAAHDPVHKVAVIDTEGLL
GATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFLGDASEAYLKHFTKELKATTA
RCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEAPEKLIQDRFRKLGRFPEAFSSIHYK
GTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS
FFPDEYFTCSSLCLSCGAGCKNSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGK
EVSVVPKTSASTDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIV
HVWPGTDAFLKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQ
ILSCNQCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYDARNV
QLDVAEAQADDEGGTLIARKVGEAVQNTLGAVVTAIDIPLGLVKDAARPAYWVPDHEILH
CHNCRKEFSVKLSKHHCRACGQGFCDECSHGRRAVPSRGWDHPVRVCFNCNKKPGDL
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgagtgcccagacttccttagcagagaagggcctaaatccggggctcatgtgccaggag
agttatgcttgcagcgggactgatgaagctgtcttcgaatgcgatgagtgttgtagtttg
cagtgtctccgctgtgaggaagaactccaccggcaggagcgccttcgaaaccatgagcgg
ataagactcaaagctggtcatgtcccttactgtgacccctgcaagggccccaacgggcat
tcaccaggcgtcaggcagagggcagccgtgaggtgccagacctgcaagatcaacctgtgt
ctggagtgccagaagaggactcattcagggggtaacaagagaagacaccccgttactgtg
taccatgtcagtaaggtccaggagtctctggagggtgaagagatggatgaggagaccaag
aggaggaagatgacagagagggttgtgagcttcctcctggtagatgaaaacgaagagatc
caggtaacaaatgaagaggactttattaggaaattggactgtaagcctgaccagcatctc
aaggtggtttccatttttggaaatactggtgatggaaagtcccataccctcaaccacact
ttcttccatggccgagaagtcttcaaaacgtcccctgctcaggagtcctgcactgtggga
gtgtgggcagcccatgacccagtccataaggtagcagtgatagacacagaagggctcttg
ggggccaccgtgaatctgagccagaggacacggctgctgctaaaggtcctggccatctca
gacttggtcatctatcgaactcatgcagaccggctgcacaatgacctcttcaaattcctt
ggggatgcctcggaagcttacctgaagcactttaccaaggaactcaaggctaccactgca
cgctgtggcctggatgtccccttatccactctgggccctgcagtcattattttccacgag
actgtgcacactcagcttctgggttctgatcacccctcagaggctcctgagaagctcatc
caggaccggttcaggaagctgggccgcttccctgaagcctttagctccattcattacaag
ggaacgaggacatacaatccccccacagacttctctgggcttcggcgtgccctggaacag
ctgctagagaacaacactacgaggtctcctcggcacccaggggtcatcttcaaagccctg
aaggcactaagtgaccgcttcagcggtgagatccctgatgaccagatggcgcacagttca
ttttttccagatgagtacttcacctgctcctcactctgcctcagctgtggggcgggatgt
aagaacagcatgaaccacggcaaggaaggggtgcctcatgaagccaagagccgttgtcgg
tactcacaccagtatgacaaccgagtttatacctgcaaggcctgctatgagagaggcaag
gaagtcagcgtggtgcccaaaacatccgcctccaccgactctccctggatgggtctggcg
aagtatgcctggtccgggtatgtgatcgaatgtcctaactgcggtgtggtctatcggagc
cgccagtactggtttgggaaccaagatcctgtggatacagtagttcggacagagattgta
catgtgtggcctggaacggatgcatttctgaaggataacaacaatgctgcccagcgtctg
ttggatgggatgaactttatggcccagtcagtgtctgagcttagtcttggacccactaag
gctgtgacttcttggctaacggaccagatcgctcctgcctactggaggcccaactcccag
atcctgagctgcaaccagtgtgcgacatccttcaaggacaacgacaccaagcatcactgc
cgggcctgtggtgagggcttctgtgacagctgttcatccaagacccggccagtgcccgag
aggggctggggacctgcgcctgtccgtgtgtgtgacaactgctacgacgccaggaatgtc
cagttagatgtggctgaggcgcaggcagatgatgaaggcggaacgctgatcgccaggaag
gtgggcgaggccgtgcagaacaccttgggagccgtggtgacagctattgacataccacta
ggcctggtgaaagatgctgccaggccggcctactgggtgcccgaccacgagatcctgcac
tgccacaactgccgcaaggagttcagtgtcaagctctccaagcaccactgccgagcctgc
ggacagggcttctgcgacgagtgctcccatggccgcagggctgtgccctctcgaggctgg
gaccatccagtccgagtctgcttcaactgcaataaaaagcctggtgacctttaa

DBGET integrated database retrieval system