KEGG   Rattus norvegicus (rat): 299331
Entry
299331            CDS       T01003                                 

Gene name
Hsp90aa1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno05132  Salmonella infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    299331 (Hsp90aa1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    299331 (Hsp90aa1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    299331 (Hsp90aa1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    299331 (Hsp90aa1)
   04612 Antigen processing and presentation
    299331 (Hsp90aa1)
   04659 Th17 cell differentiation
    299331 (Hsp90aa1)
   04657 IL-17 signaling pathway
    299331 (Hsp90aa1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    299331 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    299331 (Hsp90aa1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    299331 (Hsp90aa1)
   05207 Chemical carcinogenesis - receptor activation
    299331 (Hsp90aa1)
  09162 Cancer: specific types
   05215 Prostate cancer
    299331 (Hsp90aa1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    299331 (Hsp90aa1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    299331 (Hsp90aa1)
   05418 Fluid shear stress and atherosclerosis
    299331 (Hsp90aa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    299331 (Hsp90aa1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    299331 (Hsp90aa1)
   04131 Membrane trafficking [BR:rno04131]
    299331 (Hsp90aa1)
   03051 Proteasome [BR:rno03051]
    299331 (Hsp90aa1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    299331 (Hsp90aa1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    299331 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     299331 (Hsp90aa1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   299331 (Hsp90aa1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    299331 (Hsp90aa1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    299331 (Hsp90aa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    299331 (Hsp90aa1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   299331 (Hsp90aa1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 299331
NCBI-ProteinID: NP_786937
RGD: 631409
Ensembl: ENSRNOG00000059714
UniProt: P82995
Position
6
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaagaggaggtcgaaaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaacactttctactcgaac
aaagagatctttctgagggagctcatttccaactcctcagacgctctggataagatcaga
tacgagagcttgaccgaccctagtaaactggactcggggaaggagctgcacattaatctc
attcccaacaagcaagaccgaaccctcactattgtggatactggcattggaatgaccaag
gctgacttgatcaataaccttggcactattgccaagtcaggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcgtatttggttgctgagaaagtgactgtcatcaccaagcataatgatgacgagcagtac
gcctgggagtcctcagctggaggatccttcactgtgaggacagacacaggtgaaccaatg
ggtcgtggaacaaaggttatcttgcatctaaaagaagaccaaactgagtatttggaggaa
aggagaataaaagaaattgtgaagaaacattctcagtttattggctaccccattactctc
tttgtggagaaggaacgtgacaaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgacaagcctgaaatagaagat
gttggttctgatgaagaagaagaagagaagaaggatggtgacaagaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatctggaccaga
aatcctgatgacattacgaatgaagaatacggagagttctacaagagcttaaccaacgac
tgggaagaacatttggcagtaaagcatttttctgttgaaggacaattagaattccgggct
cttctttttgtcccaagacgcgctccttttgatctatttgaaaacagaaagaaaaagaac
aacatcaagttgtatgttcgcagagtttttatcatggataactgtgaggagttaatcccc
gagtatctgaatttcatcagaggggtggtggattctgaggatctccctctaaatatttcc
cgtgaaatgctgcaacaaagcaaaattctgaaagttatcaggaagaatttggtcaagaaa
tgcctagaactatttactgaactggctgaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcatgaagactctcaaaatcggaagaagctt
tcagagctgttgagatactacacatctgcttctggggatgagatggtttctctgaaggac
tactgcaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactcagcctttgtggaacgtctccgaaagcatggcttagaagtaatc
tatatgattgagcccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtcagttaccaaagaaggactggaacttccagaagatgaagaggaaaagaag
aaacaggaagagaaaaagacaaaatttgagaacctctgcaaaattatgaaggatatttta
gagaaaaaggttgaaaaggtggttgtgtcaaaccgattggtgacatccccatgctgtatt
gtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaagtctgtg
aaagatctggtcatcttgctgtacgaaacagcactcctgtcttccggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgtggatgataccagtgctgctgtaactgaagaaatgccacccctg
gaaggagatgatgacacatcacgcatggaagaagtagactag

KEGG   Rattus norvegicus (rat): 301252
Entry
301252            CDS       T01003                                 

Gene name
Hsp90ab1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04612  Antigen processing and presentation
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno05132  Salmonella infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    301252 (Hsp90ab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    301252 (Hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    301252 (Hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    301252 (Hsp90ab1)
   04612 Antigen processing and presentation
    301252 (Hsp90ab1)
   04659 Th17 cell differentiation
    301252 (Hsp90ab1)
   04657 IL-17 signaling pathway
    301252 (Hsp90ab1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    301252 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    301252 (Hsp90ab1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    301252 (Hsp90ab1)
   05207 Chemical carcinogenesis - receptor activation
    301252 (Hsp90ab1)
  09162 Cancer: specific types
   05215 Prostate cancer
    301252 (Hsp90ab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    301252 (Hsp90ab1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    301252 (Hsp90ab1)
   05418 Fluid shear stress and atherosclerosis
    301252 (Hsp90ab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    301252 (Hsp90ab1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    301252 (Hsp90ab1)
   04131 Membrane trafficking [BR:rno04131]
    301252 (Hsp90ab1)
   03051 Proteasome [BR:rno03051]
    301252 (Hsp90ab1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    301252 (Hsp90ab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    301252 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     301252 (Hsp90ab1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   301252 (Hsp90ab1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    301252 (Hsp90ab1)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    301252 (Hsp90ab1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    301252 (Hsp90ab1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   301252 (Hsp90ab1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 301252
NCBI-ProteinID: NP_001004082
RGD: 1303075
Ensembl: ENSRNOG00000019834
UniProt: P34058
Position
9
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaagaggtggagaccttcgcctttcaggcagaa
attgcccagctgatgtccctcatcatcaacactttctactcaaacaaagagattttcctc
cgggagttgatctctaatgcttctgatgccctggacaagattcggtatgagagcctgact
gacccttccaagttggacagcgggaaagagctgaagattgacatcatccccaaccctcag
gaacgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcataaat
aacttgggaaccattgctaagtctggtacaaaggcgttcatggaggctctccaggctggt
gcagacatctccatgattgggcagtttggtgtcggcttctactctgcctacctggtggca
gagaaagtggttgtgatcacgaagcacaacgatgatgagcagtatgcctgggagtcttct
gctggtggatccttcactgtccgtgcagaccacggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttagaggagaggagggtcaaggag
gtggtgaagaaacactcacagttcataggctaccccatcaccctctatctggagaaggaa
cgcgagaaggagatcagtgatgatgaggcagaggaagagaaaggggagaaggaggaggaa
gataaggaggatgaggagaagcctaagattgaggatgtgggatctgatgaggaggatgac
agcggcaaagataagaaaaagaaaacaaagaagatcaaggagaagtacattgaccaggaa
gagctgaataagacgaagcccatctggaccagaaatcctgatgacatcactcaagaggaa
tatggtgaattctacaagagcctcaccaatgactgggaagaccacttggcagtcaagcac
ttctctgtagaagggcagttggaattcagggcattgctcttcattccccggcgagctccc
tttgacctctttgagaacaagaagaagaagaacaacatcaaattgtatgtccgtcgtgtg
ttcatcatggacagctgtgatgagctgatacctgagtacctcaacttcatccgtggtgtg
gttgattccgaggacctgcctctgaacatctcccgagaaatgctccagcagagcaagatc
ctgaaagtcatccgcaaaaacattgtgaagaagtgccttgagctcttctctgagttggct
gaagacaaagagaactacaagaaattttatgaggcattctctaagaatttaaagcttgga
atccatgaggattccactaaccgtcgccgcctctctgagctccttcgctaccatacctct
cagtctggagatgagatgacttccctgtcagagtatgtgtctcgcatgaaggagacacag
aagtccatctactatatcactggtgagagcaaagagcaggtggccaactctgccttcgtg
gagcgtgtgcggaaacggggctttgaggtggtatacatgactgagcccattgatgagtac
tgcgtacagcagctcaaggagttcgatggcaagagcctggtctccgtgaccaaggagggc
ctggagctaccagaggatgaggaagagaagaaaaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaagtgactatc
tccaataggcttgtgtcttccccctgctgcattgtgaccagcacctacggctggacagcc
aacatggaacggattatgaaggcccaggcactgcgggacaactcgacaatgggctacatg
atggccaagaaacacctagagatcaaccctgaccaccccattgtggagactctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaagacctggtggtgctgctgtttgag
actgctctgctctcctctggcttctcacttgaggacccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcattgatgaagatgaggtcactgcagaagagccc
agtgctgctgttcccgatgagatccccccactggagggtgatgaggatgcctctcgcatg
gaagaagtggattaa

KEGG   Rattus norvegicus (rat): 362862
Entry
362862            CDS       T01003                                 

Gene name
Hsp90b1
Definition
(RefSeq) endoplasmin precursor
  KO
K09487  heat shock protein 90kDa beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04657  IL-17 signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno05132  Salmonella infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    362862 (Hsp90b1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    362862 (Hsp90b1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    362862 (Hsp90b1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    362862 (Hsp90b1)
   04918 Thyroid hormone synthesis
    362862 (Hsp90b1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362862 (Hsp90b1)
   05207 Chemical carcinogenesis - receptor activation
    362862 (Hsp90b1)
  09162 Cancer: specific types
   05215 Prostate cancer
    362862 (Hsp90b1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362862 (Hsp90b1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    362862 (Hsp90b1)
   05418 Fluid shear stress and atherosclerosis
    362862 (Hsp90b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    362862 (Hsp90b1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   362862 (Hsp90b1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 362862
NCBI-ProteinID: NP_001012197
RGD: 1310482
Ensembl: ENSRNOG00000026963
UniProt: Q66HD0
Position
7
AA seq 804 aa
MRVLWVLGLCCVLLTFGFVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALAGNEELTVKIKCDREKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVRKYSQFINFPIYVWSSKTETVEEPLEEDETAQ
EEKEEADDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKSKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVMDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPEAQVEEEPEEEPEDTTEDTTDDSEQDEEE
TDAGAEEEEEEQETEKEPTEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggtcctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtttgtgaga
gctgacgatgaagtcgatgtggatggcacggtagaagaggacctgggtaaaagtagagaa
ggctcacggacagacgatgaagttgtgcagagagaggaagaagctattcagttggatggt
ttaaatgcatcacaaataagggaacttagagaaaaatcggaaaagttcgccttccaagct
gaagttaacaggatgatgaaacttatcatcaattctttgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagacaagataaggctcatctcacta
actgatgaaaatgcacttgctggaaatgaggagttgacggtcaagattaagtgtgacaga
gagaaaaacctgctgcatgtcacagacacgggtgtaggaatgaccagagaggagctggtt
aaaaacctgggcaccatagccaaatctggaaccagcgagtttctaaacaaaatgacagaa
gcacaagaagacggtcagtcaacttccgaactgatcggccagtttggtgtcggtttttat
tctgccttccttgtagcagataaggtcattgtcacgtcgaaacacaacaatgatacccag
cacatctgggaatccgactctaatgaattctctgtgattgctgacccaagaggaaacaca
ctaggtcgtggaacaacgattactcttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcagaaagtattctcagttcatcaactttcccatctat
gtgtggagtagcaagactgagactgtggaggagcccttggaagaagacgaaacagcacaa
gaagagaaggaggaagctgatgatgaagccgcagtagaagaggaggaggaagagaagaag
ccaaagacgaagaaagttgaaaagactgtgtgggactgggaacttatgaatgacatcaaa
ccaatatggcagaggccgtccaaagaagtagaagaagacgagtacaaagctttctacaag
tcgttttcaaaggaaagtgatgaccccatggcttatatccactttactgcagaaggggaa
gtcaccttcaagtcaattttgtttgtgcctacatctgcgcctcgaggtctgtttgacgag
tatggatctaagaagagcgattatattaagctctatgtgcgccgagtgttcatcacagac
gacttccatgacatgatgcccaagtacctgaattttgtcaaaggtgttgtggattccgat
gatctccccctcaatgtttcccgtgagactcttcagcaacataaattgctcaaggtgatt
aggaagaagcttgtccgcaaaactctggacatgatcaagaagatcgctgatgagaaatat
aatgacactttctggaaagaatttggcaccaatatcaagcttggtgtgattgaagatcac
tcaaatcgaacacggcttgctaaacttcttaggttccagtcttctcaccattcaactgac
attactagtttagaccagtatgtggaaagaatgaaggaaaaacaggacaaaatctacttc
atggctgggtcaagcagaaaagaggctgaatcttctccgtttgttgagaggcttctgaag
aagggctatgaagttatttacctcacagagcccgtggatgaatactgcattcaggctctt
cctgagtttgatgggaaacggttccagaatgttgccaaagaaggagtgaagtttgatgag
agtgagaaaagtaaagaaagtcgggaagcaacagagaaggagtttgagcctctgctcaac
tggatgaaagataaggccctcaaggacaagatcgaaaaggctgtggtgtcccagcgcctc
acagagtctccctgtgcccttgtggccagccagtatggatggtctggaaacatggagagg
atcatgaaggcacaagcataccagacgggcaaggacatctctacaaattactatgccagt
cagaagaaaacgtttgaaattaatcctagacacccactgatcagggacatgctgcggagg
gttaaggaagatgaagatgacaagactgtcatggatcttgctgtagttttgtttgaaacg
gcaactcttcggtcaggataccttctacccgacaccaaggcatatggagacaggatagaa
aggatgctccgcctcagcttaaacattgaccctgaagcacaggtagaggaagagccagag
gaggagcctgaagacaccacagaagacaccacagatgactccgagcaggatgaagaagag
acagacgcaggggcagaagaagaagaagaagaacaggaaacagaaaaggaacctacagag
aaggatgaattgtaa

DBGET integrated database retrieval system