KEGG   Rattus norvegicus (rat): 300121
Entry
300121            CDS       T01003                                 

Symbol
Smc1b
Name
(RefSeq) structural maintenance of chromosomes protein 1B
  KO
K06636  structural maintenance of chromosome 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    300121 (Smc1b)
   04114 Oocyte meiosis
    300121 (Smc1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    300121 (Smc1b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    300121 (Smc1b)
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex and associated proteins
    300121 (Smc1b)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_23 AAA_15 AAA_29 ABC_tran Ca_chan_IQ
Other DBs
NCBI-GeneID: 300121
NCBI-ProteinID: NP_001123970
RGD: 1308791
Ensembl: ENSRNOG00000032570
UniProt: D3ZE73
Position
7
AA seq 1247 aa
MGHLELLLVENFKSWRGRQVIGPFKRFTCIIGPNGSGKSNVMDALSFVMGEKTTNLRVKN
IQELIHGAHIGKPVSSSASVTIIYVEDSGEEKTFTRIIRGGCSEFHFGDKPVSRSVYVAQ
LENIGIIVKAQNCLVFQGTVESISMKKPKERTQFFEEISTSGEFIGEYEAKKKKLQKAEE
DAQFHFNRKKNVAAERKHAKIEKEEAEHYQSLLEELKTNKIQLMLFQLYYNEEKINVLNT
ELEHMDRNLSVVKDTLSHHENIIKAKKKDYGMLTRQLQQTAKELKSVEAVLNQKRPQYIK
AKENTSHHLKKLDLSKKLITDNEKQCAKQEDGIRALVAELVDLDRAWRSFEKQMEEKILH
KGRDIELENSQLDRYKELKEQVRRRVGIMTQQLEKLQWEQKAEKERLAFERRRHGDTQGN
LKQIKEQIEEHKKRIEKLEEYTKTCMDCLEDKKQQEEALIKEIDNTKSRMSEVNEELSLI
RNELQNAGIDNHEGKRQRKRAEVLEHLKRLYPDSVFGRLLDLCHPIHKKYQLAVTKLFGR
YMVAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLREIKGCKMMIDVIKT
QFPQLKKVIQFVCGNGLVCETVEEARHIAFGGPERRKAVALDGTLFLKSGVISGGSSDLK
HKALCWDEKELHSLRDKRNQLVQELKELMKTLRKETDLKQIQALVQGTNTRLKYSQNELE
MIKKKHLATFYREQSQLQSELLNIDSQCTMLSEGINKQQQKIEEFQDKIDKVEDDIFQDF
CEEIGVENIREFENKHVKQQQENDQKRLEFEKQKTRLNIQLEYSRNQLKKKLNKIDTLKT
TIQKGREDIDNLKKTEEECLKIVEELMVKQEQVKEVLATQSSNIEKIHIQIEEERKKFLA
VDREVGKLQKEVVIIQGSLEQKQLEKHNLLLDCKVQDIDISLMLGSLEDIIEVELTETES
TQATADIYEKEASIQIDYSPLREDWKALQSDKEVEAHLTLLLQQVASQENTLLKTAAPNL
RAQENLKAVRDKFQESADAFEASRKEARICRQEFEQVKRRRYDAFSQCFEHISVSIDQIY
KKLCRNNSAQAFLSPENPEEPYLDGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVH
SFRPAPFFVLDEVDAALDNTNIGKVSGYIKEQSQEQFQMIIISLKEEFYSRADALIGVYP
EHDECMFSHVLTLDLSKYPDTEDQEGSRSHRKPRARVSQSPQSPQSR
NT seq 3744 nt   +upstreamnt  +downstreamnt
atggggcaccttgagttgctgctcgtggagaatttcaagtcgtggcgaggccgccaggtc
atcggccctttcaagaggttcacctgtatcatcggccccaacggctcgggaaagtctaat
gtaatggatgcacttagttttgtaatgggagaaaaaacaactaatttaagagtaaaaaac
attcaagaacttattcatggagcacacattggaaaacctgtttcttcttctgcaagtgtg
accattatatacgtagaagacagtggagaagagaaaacattcacaaggattatccgaggg
gggtgctcagaatttcattttggggataaacctgtgagtcgttctgtgtatgtagcccag
ttggaaaacataggcataatagtcaaagcacagaactgtctagtttttcagggaactgta
gagtcaatatccatgaaaaaacccaaagagagaacccaattttttgaagaaatcagtact
tcaggagagtttataggagaatatgaggcaaagaaaaagaagttacaaaaagccgaagaa
gatgcacaatttcattttaacaggaaaaaaaatgtagctgcagaacggaagcatgcaaaa
atagagaaagaagaggcagaacattatcaaagtctccttgaagaattgaaaacaaacaag
atacaactgatgcttttccaactatattataatgaggaaaaaatcaatgttttaaacact
gaattagagcatatggacaggaatttaagtgttgtaaaagacactctttctcaccatgaa
aacataattaaagctaagaaaaaggattatggaatgttaactagacaactacagcaaaca
gcaaaagaactgaaatctgtcgaagcagttttaaatcagaagaggcctcagtacattaaa
gctaaagaaaacacttctcaccatctaaaaaaattggatttgtctaagaaattgataaca
gacaatgaaaaacaatgtgctaagcaggaagatggcattcgagccttagtggcagaactg
gttgatttagatagagcatggagaagttttgaaaagcagatggaagagaaaatcttacac
aaaggaagagacattgaattggaaaatagtcagctggaccgttataaagagcttaaggaa
caagtcagacggagggtaggtataatgacacaacaactggaaaaactacagtgggaacag
aaggcagaaaaagaaagactggcatttgaaaggaggaggcatggagacactcagggaaat
ctaaaacaaataaaagaacaaatagaagagcataaaaaacgaatagagaaattggaggaa
tatacaaagacgtgcatggattgcttggaagataaaaaacagcaagaagaagccctgata
aaagaaattgacaatacaaaatcaagaatgtctgaagttaatgaagaattgagtcttatt
agaaatgaattgcagaatgctggaattgataaccatgaaggaaaacgtcagcggaaaaga
gcagaagttctcgaacaccttaaaagactttacccagattctgtgtttggaagacttctt
gatctatgtcatcctattcataagaaataccagctggctgtgactaagctttttggccgg
tacatggttgccattgttgttgcctcagaaaaggtagcaaaagattgtattcggtttctg
aaggaggaaagagctgaacctgagacattccttgctctagattaccttgatatcaagcca
atcaatgaacgactaagggaaattaaaggctgtaagatgatgatcgatgttataaagacc
cagtttcctcagctgaagaaagtgattcagtttgtttgtggaaatggccttgtctgtgag
actgtggaagaggcaagacatattgcatttggtggacctgaaagacgaaaggcagtagca
cttgatggaacactgtttttgaaatctggagtgatctcaggagggtcaagtgacttaaag
cacaaagctctgtgttgggatgagaaggagttacacagtctaagagataaaagaaaccaa
cttgtccaagagctaaaggagttaatgaagacgctccgcaaggaaacagatctgaaacaa
atacaggcattagtacaaggaaccaatacacgactcaaatattcacaaaatgaactagag
atgattaaaaagaagcaccttgctacattttaccgggaacaatctcagctacaaagtgaa
ttactgaatattgattctcagtgtacaatgttgagcgaaggaatcaacaaacagcaacaa
aagattgaagaatttcaagataagatagacaaggtagaagatgacatattccaagacttc
tgtgaagaaattggtgtggaaaatatccgtgaatttgagaacaaacatgttaaacagcag
caagaaaatgatcaaaaaagattagagtttgaaaaacaaaaaactcggctcaatattcag
cttgaatatagtcgaaatcaacttaagaagaaactgaataagatcgacacattaaaaaca
acaatccagaagggcagagaagacattgataacctaaagaagaccgaagaagagtgtctg
aaaattgttgaagaactcatggtgaaacaagaacaagttaaggaagtgcttgccacacag
agttccaacattgagaaaattcatattcaaattgaagaggaacgcaagaagtttttggct
gttgatagggaagttggaaaattacagaaggaagttgtaatcattcagggttctttggaa
cagaaacaactagagaagcataacttgctcctggactgcaaagttcaagacattgacata
agtctcatgctggggtcattggaggacatcattgaagtggagctaactgaaacagaaagt
acccaggcaacggctgatatctatgaaaaagaagcatccatccaaatagactacagccct
ctaagggaggattggaaggctctacaatcagataaggaggtggaggcccacctcacactc
cttctacagcaagtagcatcccaagaaaatactctactgaagactgcagctccaaacctg
cgagcacaggagaacttaaaggctgtcagagacaaatttcaagaatctgcagatgctttt
gaggccagcagaaaggaagccagaatatgtaggcaagagtttgaacaggtgaaaagacgg
aggtacgatgctttcagtcagtgttttgagcacatctcggtctcaattgatcaaatctac
aagaagctctgcaggaacaacagtgcccaggcatttcttagcccagagaaccctgaagaa
ccttacttagatggaattagctataattgtgtggctccaggcaaacggttcatgcctatg
gacaacttgtcagggggagaaaagtgtgtggctgctctggctcttctgtttgctgtacac
agttttcgacctgctccattctttgtattagatgaagtagatgcagccctggacaatact
aacatcggcaaagtctcaggttacatcaaagagcagagtcaggaacaatttcagatgata
atcatttccctgaaagaggagttttactccagagctgatgcactgataggcgtctaccca
gagcacgatgaatgcatgttcagccatgtgttgactctggacctttccaagtatccagac
actgaagaccaagaaggcagcaggagccaccggaaacccagagcacgagtatcacagtcc
ccgcagtctccccagtctcgttag

KEGG   Rattus norvegicus (rat): 63996
Entry
63996             CDS       T01003                                 

Symbol
Smc1a
Name
(RefSeq) structural maintenance of chromosomes protein 1A
  KO
K06636  structural maintenance of chromosome 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    63996 (Smc1a)
   04114 Oocyte meiosis
    63996 (Smc1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    63996 (Smc1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    63996 (Smc1a)
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex and associated proteins
    63996 (Smc1a)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 AAA_23 AAA_29 ABC_tran SbcC_Walker_B Mce4_CUP1
Other DBs
NCBI-GeneID: 63996
NCBI-ProteinID: NP_113871
RGD: 61991
Ensembl: ENSRNOG00000003139
UniProt: Q9Z1M9
Position
X
AA seq 1233 aa
MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKT
LRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEE
LEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEE
DTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNK
ELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKEKDSELNQKRPQYIK
AKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQS
QGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAK
IKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQV
MEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGK
NMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRY
EPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASDLK
AKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQVQSQAHGLQMRLKYSQSDLE
QTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQSREREMKDLKEKMNQVEDEVFEEF
CREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQ
TVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGG
ANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTMDDISQEEGGSQGE
ESVSGSQRTSSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRI
AAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATN
IDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALAL
LFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESL
IGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgggtttcctgaaactgattgagattgagaactttaaatcgtacaagggtcgacaaatt
atcggaccatttcagaggttcaccgccatcattggacccaatggctctggtaagtcaaat
ctcatggatgccatcagctttgtgcttggtgaaaaaaccagcaacctgagggtaaagacc
ctgagggacctgatacacggagctcctgtgggcaagccggctgccaaccgagcctttgtc
agcatggtctactccgaggagggtgctgaggaccgcacctttgcccgagtcattgtaggg
ggctcttctgagtacaagatcaataacaaagttgtccagctacatgaatacagtgaagag
ttagagaagttgggcattctcatcaaagctcgtaacttcctcgtcttccagggtgcagtg
gaatctattgccatgaagaaccccaaggagaggacagctttatttgaagaaattagtcgc
tctggggaacttgcacaggagtatgacaagcgaaagaaagaaatggtgaaggctgaagaa
gacacacagtttaattatcatcgcaagaaaaatattgcagctgaacgcaaggaggccaaa
caagaaaaggaagaggctgaccgctaccagcgcctgaaggatgaggtagtacgcgcacag
gtacaattgcagctttttaaactctaccacaacgaagtggagattgagaagctcaacaag
gaactggcctcgaagaacaaggaaattgagaaggacaaaaagcggatggacaaggtagag
gatgaactgaaggagaagaagaaagagctgggcaaaatgatgcgggaacagcagcagatt
gagaaggagatcaaggaaaaggactcagaattgaatcagaagaggcctcagtacatcaaa
gcaaaagagaatacatcccacaaaatcaagaagcttgaagcagccaagaaatctctgcag
aatgctcagaaacattataagaaacgtaaaggtgacatggatgagctggagaaagagatg
ctgtcagtggagaaggcccgacaggagtttgaagagcggatggaggaagagagtcagagt
caaggcagagacttgaccctggaggagaaccaggtaaagaaataccaccgattaaaagag
gaagctagcaagagagcagccactttggctcaggagctggagaagtttaatcgagaccag
aaagctgaccaggaccgtctagatctagaagagcggaagaaagtagagacagaggccaag
atcaagcaaaaactgcgggagattgaagagaatcagaaacggattgagaagctagaggaa
tatattaccactagcaagcagtctctagaggaacagaagaagctagagggagaattgaca
gaagaagtagagatggccaagcgtcgtattgatgagatcaataaggagctgaaccaggtg
atggagcaattgggggatgcgcgcattgaccggcaggagagcagccgccagcagaggaag
gcagaaataatggaaagcatcaagcgtctctaccctggttctgtgtatggccgcctcatt
gacctctgccagcctacacaaaagaagtatcagattgctgtgaccaaggttttaggaaag
aacatggatgctattattgtagactccgagaagacaggtcgggattgtattcagtatatc
aaggagcaacgtggagagcctgagaccttcttgcctcttgactacctggaggtgaaacct
actgatgagaaactccgagaactgaagggggccaagctagtgattgatgtgattcgctat
gagccacctcacatcaaaaaagctctgcagtatgcttgtggcaatgcccttgtttgtgac
aatgtggaggatgcgcgacgaattgcctttggaggtcaccaacgccacaagacagtggca
ttggatggcaccctgttccagaagtcaggagttatctctggtggagccagtgatctcaag
gcaaaggcacgacgctgggatgagaaggcagtagacaaactaaaagaaaaaaaagaacgt
ttgacggaggagctaaaagagcagatgaaggcaaaacgaaaagaggcagagctgcgtcag
gtgcagtctcaggcccatgggctacaaatgcggctgaagtactcacagagtgacctagaa
cagactaagacaaggcatcttgccctgaatctccaggaaaaatctaagctggagagtgaa
ctagccaacttcgggcctcgaattaatgatatcaagagaatcatacagagccgagagagg
gaaatgaaagacttgaaggagaagatgaaccaggtggaagatgaggtgtttgaagagttt
tgtcgggagattggtgtgcgtaacatccgcgaatttgaggaagaaaaggtgaagcggcag
aatgaaattgccaagaaacgcttggaatttgagaatcagaagactcgcttgggcatccag
ttggattttgaaaagaatcagttgaaggaggaccaggataaagtacacatgtgggagcag
acagtaaaaaaggatgaaaatgagatagaaaagcttaagaaggaggagcaaagacacatg
aagataatagatgaaaccatggctcagctccaagaccttaagaatcagcacctggccaaa
aagtcagaagtgaatgacaagaatcatgagatggaagaaattcgcaagaagcttgggggt
gccaataaggaaatgactcacttacagaaggaagtgacagccattgagaccaagcttgaa
cagaagcgcagtgaccgccacaacctgctacaggcctgtaagatgcaggacatcaaattg
ccactgtcaaagggcaccatggatgatattagtcaggaagaaggtggctcccagggagaa
gagtcagtgagtggttcccagagaacatctagtatctatgcacgagaggccctcattgag
attgactacggtgacctgtgtgaagatctgaaggatgcacaggcggaagaagaaatcaag
caagagatgaacacactccagcaaaagctgaatgagcagcagagtgtgcttcagaggatt
gctgcccctaacatgaaggccatggaaaagctggaaagtgtccgagacaagttccaggag
acctcagatgaatttgaggcagcacgaaagcgagcaaagaaagccaagcaggcatttgaa
cagataaagaaggagcgctttgaccgattcaatgcttgttttgaatctgtggctaccaat
attgatgagatctacaaggctctgtcccgtaacagcagtgcccaggcattcttgggcccc
gagaatcctgaagagccctatttggatggtatcaactacaactgtgtagctcctggcaaa
cgtttccggcctatggacaatttgtcaggcggggagaagacagttgccgcactggccttg
ctttttgccattcacagctacaagccagcccccttcttcgtcctggatgagattgatgct
gccttggataacaccaacattggcaaggtggcaaattacatcaaggagcagtcaacttgc
aacttccaggccattgttatctctctcaaggaggaattctacaccaaggctgagagcctc
attggagtctatcctgagcaaggagactgtgtgatcagcaaagtcctgaccttcgacctc
accaagtatccagatgccaaccctaaccccaatgaacaatag

DBGET integrated database retrieval system