KEGG   Rattus norvegicus (rat): 300711
Entry
300711            CDS       T01003                                 

Symbol
Atm
Name
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03440  Homologous recombination
rno04064  NF-kappa B signaling pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05202  Transcriptional misregulation in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    300711 (Atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    300711 (Atm)
   04068 FoxO signaling pathway
    300711 (Atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    300711 (Atm)
   04210 Apoptosis
    300711 (Atm)
   04115 p53 signaling pathway
    300711 (Atm)
   04218 Cellular senescence
    300711 (Atm)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    300711 (Atm)
   05206 MicroRNAs in cancer
    300711 (Atm)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    300711 (Atm)
   05170 Human immunodeficiency virus 1 infection
    300711 (Atm)
   05165 Human papillomavirus infection
    300711 (Atm)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    300711 (Atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    300711 (Atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    300711 (Atm)
   03400 DNA repair and recombination proteins [BR:rno03400]
    300711 (Atm)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     300711 (Atm)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   300711 (Atm)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    300711 (Atm)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    300711 (Atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 300711
NCBI-ProteinID: NP_001100291
RGD: 1593265
Ensembl: ENSRNOG00000029773
UniProt: D4ACL8
Position
8
AA seq 3064 aa
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETESLRTAKSNVSASTQTSRQKKMQEISSLVRFFIKCANKRAPRLKCQDL
LNYVMDTVKDSSNGATYGADCSNILLKDILSVRKYWCEVSQQQWLELFSLYIRLYLKPSQ
DINRVLVARIIHAVTRGCCSQTDGLPSKFLDLFSKAIQYARQEKSSPGLSHILAALNIFL
KTLAVNFRKRVCEIGDEILPTLLYIWTQHRLNDSLKEVIIELIHLQIYIHHPQGAKAPEE
GAYESMKWKRILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADVCYQLFNAD
TRSVEISQSYATQRESTDYSVPCKRRKIDIGWEVIKDYLQKSQNDFDLVPWLQITTRLIS
KYPSSLPNCELSPLILILYQLLPQQRRGERIPHVLRCLTEVALCQGKKSNLESSQKSDLL
KLWIKIWSITFRGISSEQTQTENFGLLGAIIQGSLVELDREFWKLFTGSACKPSSPSVRC
LTLALSMCVVPDAIKMGTEQSVCDANRSFSVKESIMRWLLFYQLEGDLEDSAEPPPILQS
NFPHLILEKILVSLTMKNSKAAMKFFQSAPECEQHCEDTEEPSFSEAEELFLQTTFDKMD
FLTPVKEDTVEKFQSRVGFSVHQNLKESLDHYLLGLSEQLLSNYSSEITSSETLVRCSSL
LVGVLGCYCYMGVITEDEAYKSELFQKAKSLMQCAGESISLFKNKTNEESRVGSLRSVIH
LCTSCLCRHTKHTLNKIASGFFLRLLTSKLMNDIADICKSLASCTKKPFDYGEEHSLRDD
DDDGDGGDGGESLMETQGSSSTDLFSDYSASTVSDANDYGENQNAVGAANPLTADWLSRQ
DHLLLDMLRFLCLSVTACQSRTASFRGADIRRKLLMLLDPSTLDLTKSLHLHMYLVLLKD
LPGKEHLLPMEDVVELLQPLSLVCSLYRRDQDVCKTILSNVLHIVTNLGQGSVDTESTRN
AQGQFLTVMGAFWHLTKEKKCIFSVRMALVKCLQTLLEADPYSKWAILNVKGQDFPVREA
FPQFLADGHHHVRMLAAGSISRLFQDMRQGDSSRSLKALPLKFQQTSFNSAYMIAEAGIR
ELLCDSQNPDLLDEIYNRKSVLLTVIAVVLHCSPICEKQALFALCKSVKENGLEPHLVKK
VLEKVSESFGCRCLEDFMASHLDYLVLEWLNLQDAKYSLSSFPFTLLNYMSVEDFYRSCY
KILIPHLVIRKHFDEVKSIANQIQRCWKSLLIDCFPKMLVHILPYFACEGTGDSSSAQKR
ETATEVYDTLKGEDFLGKQIDQVFISNLPEIVVELLMTLHETADSDSGQSPDLCDFSGDL
DPAPNPPYFPSHVIKATFAYISSCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNV
FKKHRILKIYHLFVSLLLKDIQSGLGGAWAFVLRDVIYTLIHYINKRSSHFTDVSLRSFS
LCCDLLSRVCRTAVTHCKDALENHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIDNKDNK
NLFVTIKLLDPFPDHVVFKDLRLTQQKIKYSGGPFTLLEEINHFLSVSAYNPLPLTRLEG
LKDLRRQLEQHKDQMLDLVRASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGR
CLGEIGPLDFSTIAVQHSKDTPYTKAYGLPEDRELQWTLIMLTALNNTLVEDSVKIRSAA
ATCLKNILATKTGHIFWENHKTSADPMLTYLQPFRASRKKFLELPQFVKEDALEGLDDVN
LWVPQSESHDIWIKTLTCAFLDSGGIKSEILQLLKPMCEVKTDFCQMVLPYLIHDVLLQD
THESWRTLLSTHVRGFFTNCFKHSSQASRSATPANSDSESENFLRCCLDKKSQRTMLAVV
DYLRRQKRPSSGTAFEDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYSDKKNMDEQEKR
SPTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKVLQPLTRI
RTYEHEATWEKALVTYDLETTISSSTRQSGIIQALQNLGLSHILSIYLKGLDHERREWCG
ELQELHYQAAWRNMQWDLCTSANQELEGTSYHESLYNALQCLRNREFSTFYDSLRHARVK
EVEELSKGSLESVYSLYPTLSRLQAVGELENSGELFSRSVTDRERSEVYLKWQKHSQLLK
DSDFSFQEPLMALRTVILEILVQKEMENSQGGCSKDILTKHLVEFSVLARTFKNTQLPER
AIFKIKQYNPAICGISEWHLEEAQVFWAKKEQSLALSILKQMIKKLDSSFREVCNEAGLK
GLHAECLRVCGNWLAETCLENPAVIMQTYLEKAVKVAGSYDGDSRELRNGQMKAFLSLAR
FSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLIREHKIQTNRYTIKVQRELELDECAL
RALKEDRKRFLCKAVENYISCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMKRDGMKIS
SYKFLPLMYQLAARMGTKMTGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFL
SKPETARRGRITKNAPKESSQLDEDRAEAASRIIHTIRSARRTMVKDMEALCDAYIILAN
LDASQWRNQRKGISIPANQPITKLKNLEDVVVPTMEIKVDPTGEYEKLVTIKSFKTEFRL
AGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNMLLQRNTETRKRKLTI
CTYKVVPLSQRSGVLEWCTGTIPIGEYLVNNEEGAHKRYRPNDLSANQCQKKMMEVQKKS
FEEKYETFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCE
KTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETDLQSTPSADDQECK
RSLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGW
KAWV
NT seq 9195 nt   +upstreamnt  +downstreamnt
atgagtctagcgctgaatgacctgctcatctgctgccggcagttagaacatgacagggct
acagaacgaaggaaagaagtggataaatttaagcgcctgattcaggatcctgaaacagtt
caacatttggataggcattctgactccaaacaagggaaatatctgaattgggatgctgtt
ttcaggtttttgcagaagtacattcaaaaggaaacagaaagtcttagaacagcaaaatca
aatgtctcagcctctacacaaacctccagacagaagaagatgcaagagattagcagtctg
gtcagattcttcatcaaatgtgcaaataaaagagcacccaggctaaaatgtcaggacctc
ttgaattacgtcatggatacagtgaaagactcatctaatggcgcaacttacggagctgac
tgcagcaacattcttctcaaagacatcctgtctgtgaggaaatactggtgtgaagtgtct
cagcagcagtggctagaattgttttccctgtacatcaggctgtatctcaaaccatcacag
gacattaatagagttttagtggctagaataattcatgctgtcaccagaggatgctgctca
cagactgatggattaccttcaaagttcttagatcttttttccaaggctattcagtatgcc
agacaggaaaagagctctcctggcttaagtcacatcttagcagcccttaacattttcctc
aagactttggctgtcaacttccgaaagcgggtgtgtgaaataggagatgaaattcttcct
accttactgtatatttggactcaacatcgacttaatgactccttaaaagaagtaattatt
gaactaattcacctgcagatttacatccatcatccacagggagccaaagcgcctgaggaa
ggtgcttatgaatccatgaaatggaaaaggatcttgtacaacttatacgacctgctggtg
aatgagataagtcacataggaagcagagggaaatactcctcaggatctcgtaatattgct
gtcaaggaaaatttgattgacttgatggcagatgtctgttaccagctttttaatgcagat
accagatccgtggagatttctcagtcttatgcgacacaaagggaatccactgactacagt
gtaccttgcaaaagaaggaaaatagacataggctgggaagtgataaaagattatcttcag
aagtcacagaatgattttgatcttgtgccatggctacagattacaacccgattaatatca
aaatatccttccagtttgcctaactgtgagctgtctccattaatactgatcctgtaccag
cttctgcctcaacagcggcgtggagaacgcatcccacatgtgttacgatgccttaccgaa
gttgccttatgtcaaggcaagaaatcaaacctagaaagctctcaaaagtcagatttattg
aaactatggattaaaatttggtctattacctttcgtggtataagttctgaacaaacacaa
actgaaaactttggtttacttggggccattattcaaggtagtttagttgaacttgacaga
gaattctggaagttatttactggctcagcctgtaaaccttcaagtccttcagttcgctgc
ttgactttggcgcttagcatgtgtgtagttccagatgcaataaaaatgggaacagaacaa
agtgtgtgtgacgcaaatagaagtttttctgtgaaggagtcgataatgaggtggctctta
ttctaccagttagagggcgacttggaagacagcgcagagccgcctcccattctccagagt
aatttccctcatctcatactggaaaaaattcttgtaagtctcactatgaaaaactcaaaa
gctgcaatgaagttttttcaaagtgccccagaatgtgagcagcactgtgaagatacagaa
gagccttcgttctcagaagcggaagaactgtttctccagacaacttttgacaagatggat
tttttaactcctgtcaaagaagatactgtagaaaaatttcaatctcgtgttggcttctct
gtccaccaaaatctcaaggaatcactggatcattatcttctgggattatcagaacagctt
ttaagtaattactcttctgagattacaagttcagaaacccttgtccggtgttcgagtctt
ctggtgggtgttcttggctgctattgttacatgggtgtaataactgaagacgaagcatat
aaatcagaattattccagaaagccaagtctctgatgcagtgtgcaggggaaagtatctct
ttgtttaaaaataagacaaatgaggagtccagagttggttcactgagaagtgtgatacat
ctgtgtacaagttgcttgtgtagacataccaagcacactctaaacaagatagcctctggc
tttttcctgcgattattaacgtccaagctcatgaatgacattgcagatatttgtaaaagc
ttggcatcctgtacgaaaaagccatttgactatggagaggagcattcgttgagagatgat
gatgatgatggtgatggtggtgatggtggtgaaagtctgatggagacacagggttcatca
tccacagatctatttagcgattactctgctagtactgtgagcgatgcaaacgattatgga
gagaaccagaatgctgttggtgccgcgaatcctctaactgctgactggctgtccagacaa
gatcatcttcttttagacatgctcaggttcttgtgcctctctgtaactgcatgtcagagc
cggactgcgtctttcagaggagctgatattagaagaaagttgttaatgttactcgatcct
agcacactcgatctcactaaatccctacacctacacatgtacttggtgcttttgaaggat
ctccctggaaaagagcatttgttgccaatggaagatgttgttgaacttctgcagccatta
tcccttgtatgttctctgtatcggcgtgaccaagatgtctgcaagacgattttaagcaat
gtcctccatatagtgacaaacctaggtcagggcagcgtggacacagagagcacaaggaat
gctcaaggacagttcctgacagtgatgggagcattttggcatttaacaaaggaaaagaaa
tgtatattctctgtcagaatggcgttagtaaagtgtcttcaaacactgcttgaggctgat
ccatattccaagtgggcgattcttaatgtaaagggacaggactttcctgtacgtgaagca
tttccacagtttcttgctgacggtcaccatcacgttcggatgttggctgcggggtcgatc
agcagattattccaggatatgagacaaggtgattcctccagaagcttgaaagcacttcct
ctgaagtttcagcagacatctttcaacagtgcatacatgatagcagaggcaggaatcaga
gaactgttatgtgattctcagaaccctgatcttctggatgagatttataatagaaaatcc
gtattgctgacggtgatagctgtggtcttgcactgtagcccaatctgtgaaaagcaggct
ttgtttgccttatgcaaatctgtgaaggaaaatggactagaaccccatcttgtgaaaaag
gttttggagaaagtctccgagtcgtttggatgtaggtgcttagaggacttcatggcttct
catctagattacttggttttggaatggctgaaccttcaagatgctaaatacagcttatct
tcctttccttttacgttattaaactacatgagcgtggaggatttctatagatcttgttac
aagattctgattccacacttggtaattagaaagcactttgatgaggtgaagtccattgct
aatcagattcagaggtgctggaaaagcctgctgatcgactgctttccaaagatgcttgtg
cacatccttccgtactttgcctgtgagggcacgggggacagcagctcggcacagaagagg
gagactgctaccgaggtctacgatactcttaaaggtgaagacttcctaggaaaacagatt
gatcaagtattcattagtaatttgccagagatcgtggtggagctgcttatgacgttgcat
gaaacggctgactcggattccggtcaaagccccgacctctgcgatttttcaggggatttg
gatcccgctcccaatccaccatatttcccgtcacatgtcattaaggcaacatttgcctac
atcagcagctgtcataaaaccaagtttaaaagcattctagaaatcctttctaaaatccct
gattcctatcagaaaatactcctggccatttgtgaacaagcagctgagacaaataatgtc
tttaaaaagcacagaattcttaaaatataccacctgtttgttagtttattactgaaagac
atacagagtggcttgggaggagcttgggcctttgttctccgagatgttatttatactttg
attcactatatcaacaaaaggtcttcccatttcactgacgtgtcattacgtagcttctcc
ctgtgctgtgacctattaagtcgagtttgccgtacagcggtaactcactgtaaggacgcc
ctagaaaaccatcttcatgttattgtgggcacacttataccccttgtggattatcaggag
gttcaagaacaggtattggacctgttgaagtacttggtgatagataacaaagacaataaa
aacctctttgtcacaattaagcttctggatccgtttcctgaccatgttgtttttaaggat
ttgcgtcttactcaacagaagataaaatatagtggaggaccctttacactcttagaggaa
ataaaccattttctctcagtaagtgcttataatccacttccactgaccagactcgaagga
ctgaaggatcttcggagacaactggaacagcataaagatcagatgctagatcttgtgaga
gcatctcaggataacccacaagatggcattgtggtgaagctggttgtcagcttgttgcag
ctatccaagatggcagtgaaccagactggtgaaagagaagttttagaggctgtcggcagg
tgtttgggagaaatcggtcctctggatttctctactatagctgtacagcatagcaaagat
acgccgtacaccaaagcctacgggttacctgaagacagagaacttcagtggaccttgata
atgctgactgccctgaacaacaccctggtggaggacagtgtcaaaattcgatcagctgct
gctacctgtttgaaaaacattttggctaccaagaccggacatattttctgggagaatcat
aagacatcagcggatccaatgctgacctatctgcagcctttcagagcgtcgaggaaaaag
tttttagaattaccccagtttgttaaagaagatgctttagaaggcctggatgatgtaaat
ctgtgggttcctcaaagtgaaagccatgacatttggataaagactctgacttgtgccttt
ttggacagtggaggcataaaaagcgaaattcttcagttactaaagccaatgtgtgaagtg
aaaactgacttttgtcagatggtgctgccatacttgatccatgatgttttactccaagat
acacatgagtcgtggagaactctgctatctacacacgtccgaggatttttcactaactgt
tttaaacattcctcccaagcaagccgctcagcgactcccgcaaattcggattcagagtca
gagaactttctccgatgctgtttggataaaaaatcacaaagaaccatgctcgctgttgtc
gactacctgagaaggcaaaagaggccttcctcaggaacagctttcgaggatgccttctgg
ctagatttgaattatcttgaggttgcaaaggtggctcaatcctgtgcagctcacttcaca
gcactgctctatgcagagatctattcagataagaaaaacatggatgagcaagagaaaaga
agtccaacatttgaagaaggaagtcaaggtacaactatttctagtttgagtgaaaaaagt
aaagaagaaactggaataagcttacaggatcttctcttggagatctacagaagtatagga
gagccagacagcctgtatggctgcgggggagggaaagtgttacaaccccttacccgaata
aggacgtacgagcatgaagcaacgtgggagaaagccttagtgacatacgaccttgagacc
accatctcctcctccacccgccagtcgggaatcatccaggccttgcagaacttggggctc
tcccatattctttctatctacttgaaaggattggaccatgaaaggagagagtggtgtggg
gaactgcaggagcttcattaccaggcggcgtggaggaacatgcagtgggacctctgcact
tctgccaaccaagaactagaaggaaccagttaccacgaatcgttgtataatgctctgcag
tgcctaagaaacagagaattctccacattttatgacagtctccgacatgccagggtgaag
gaagttgaagagttgagcaaaggcagccttgaatcggtatattcgctgtaccccacactt
agcagattgcaggcagtcggagaactggaaaacagtggagagctcttctcaaggtcagtc
acagacagagagcgctctgaggtatacctgaagtggcagaagcactcccagcttctgaag
gacagtgacttcagctttcaggagcctctcatggctctccgcacagtcattctggagatc
ctggtacaaaaggaaatggagaactctcaaggaggatgctctaaggacattctcaccaaa
caccttgttgaattctctgttctggcccgaaccttcaagaatacacagctccctgaaaga
gcaatatttaaaattaagcaatataatccagctatttgcggaatctctgaatggcatttg
gaagaagcacaagtattttgggcaaagaaggagcagagtcttgccctgagtatcctcaag
caaatgatcaagaagttggactccagctttagagaggtgtgtaatgaagcaggtctaaaa
ggcctacacgcagagtgtctgagggtttgtggcaactggctggcagagacttgcctagaa
aatcctgcagtcatcatgcagacctatctagaaaaggcagtgaaggttgctggcagttat
gatggcgacagccgagagctcagaaatggacagatgaaggccttcctctcattagcgcgg
ttctctgatacgcagtaccagaggattgagaactacatgaagtcgtccgaattcgaaaac
aagcaagctctcttaaaaagagccaaggaagaagtgggtcttataagggagcataaaatt
cagacgaacagatacacaataaaggttcagagagaactggagctagatgaatgtgctctc
cgtgcactgaaagaggaccgtaaacgcttcctgtgtaaagcagttgagaactacatcagc
tgcttactaagcggagaagaacatgatctgtgggtgttccgactctgctccctctggctg
gaaaattctggagtctctgaagtcaatggcatgatgaagagagatggaatgaagatttcc
tcctataagtttttgcctctcatgtaccaattggctgctagaatggggaccaaaatgaca
ggaggcctaggatttcatgaagtcctcaataatctcatctctaggatttcaatggatcac
ccccatcacaccttgttcatcatcctggccttagcaaatgcaaacaaagatgagtttttg
agcaaaccagagacagcaagaaggggcagaataaccaagaatgcacccaaagaaagctct
cagcttgatgaggatcgagcagaggctgcaagcagaataatccatacaatcagaagtgcg
aggcgtacaatggtgaaggacatggaggcgctctgcgatgcctacatcatcctggcgaac
ctggatgcctctcagtggaggaaccagagaaaaggcatcagcattccagccaaccagcca
atcactaaactgaagaatttagaagacgttgttgttcccactatggaaattaaggttgac
cccacaggagagtatgaaaagctggtgactataaagtcatttaaaacagaatttcgctta
gccggaggcttaaatttaccaaaaataatagactgtgtgggttctgatggcaaggaaagg
agacagcttgtgaagggccgcgatgacctgaggcaagatgctgtcatgcagcaggttttc
cagatgtgcaatatgctactgcagaggaacaccgagactagaaagaggaaactgaccatc
tgcacatacaaggtggttcccctctcccagcgaagcggtgttcttgagtggtgcacagga
accatccctattggtgaatatcttgttaacaacgaagaaggtgctcataaaagatacagg
ccaaatgatctcagcgccaatcagtgccaaaagaaaatgatggaagtgcagaagaagtct
tttgaagagaagtatgagaccttcatgactatttgccaaaactttgagccagttttccgt
tacttctgcatggaaaaattcttggatccagctgtttggtttgagaaacggttggcgtat
acgcgtagtgtggccacgtcgtctatcgttggttacatccttggacttggtgataggcat
gtccagaatatcctgataaacgagcagtcagcagaacttgtgcacatagatttgggagtg
gcttttgaacaggggaagatccttcccactccagagacagttccttttagactcagcaga
gatatcgtggacgggatgggtatcactggtgtggaaggtgtcttcagaaggtgctgtgaa
aaaacaatggaagttatgcgtagttcccaggaagctctgctcaccattgtagaggttctt
ttgtacgacccgctctttgattggactatgaaccctttaaaagctttgtacttacagcag
aggccagaagacgagactgacctccagtccacccccagtgcagacgatcaggagtgcaaa
cgaagtcttagtgatactgaccagagtttcaacaaagtagctgagcgcgtcctgatgaga
ttgcaagagaagctgaaaggcgtggaggagggcaccgtgctcagtgtgggcggacaggtg
aacctgcttatccagcaggccatggaccccaaaaacctcagccgactcttcccagggtgg
aaagcgtgggtgtga

KEGG   Rattus norvegicus (rat): 685055
Entry
685055            CDS       T01003                                 

Symbol
Atr
Name
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    685055 (Atr)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    685055 (Atr)
   04115 p53 signaling pathway
    685055 (Atr)
   04218 Cellular senescence
    685055 (Atr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    685055 (Atr)
   05170 Human immunodeficiency virus 1 infection
    685055 (Atr)
   05165 Human papillomavirus infection
    685055 (Atr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    685055 (Atr)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    685055 (Atr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     685055 (Atr)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   685055 (Atr)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    685055 (Atr)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 685055
NCBI-ProteinID: XP_003750609
RGD: 1305796
Ensembl: ENSRNOG00000010027
UniProt: D3Z822
Position
8
AA seq 2636 aa
MGDHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVALELVKKTD
TQPTSVMLLDFIQHIMKSSPLMFVNVNGSQGQNEAKDSCIEFSHWIITRLLRIAATPSCH
MLHKKICEVICSLLFLFKSKNPAIFGVLTRELLYLFEDLIYLHKRNAVGDVMEWPVVVSR
FLSRLDEHMGCLQPAPLQFMNMQNVEFIEVTLLMVLIHIVPTVFFRRQELLLWQIGCALL
EHGSPKIRSLAISLLTELFELGGLPAQPASTFFSLFLELLQHLIGMDADQLKLYEEPLSK
LVKTLFPFEAEAYRNIEPVYLNVLLEKLRVMFEDRVLMRLKSDLLKAALCHLLQYFLTFV
PAGYESALQVRKVYVTDICRALVDVLGVQTHVGYLLGPFYAALKMESTEIIERIQCQAQQ
ENLRGSNDGVSPKRRRLSSSLSSYKRPSRQSEEINHVDMDKKSILWNVLKQKAESLQISL
ECGTLKNSVAEALEGITIVLQLTALCTVHCSHQDMDGHNAKDCQHKYKKKPPVVITWMSL
DFYTKVLKSCKSLLESVQKHELELVIDSVVRIYDALMYIQVKSSFQDHVLEELCGMLSLP
WIYSYSDDNSLKMTTFATNLLRLSQRVWESYSPQAQSQCVFLLTLFPKRIFLDWRTTVYN
WALKSSHEVIRTSCVKGFFILLQQENSCNQIPKMLIDRVKDDSHVVKKEFASVLGQLVCT
LHGMFYLTSSSVEPFFGPVDLFCKNLKATSQHECSSSQVKASVCKPFLFLLTKNTPSPVK
LAFIDNLHHLCKHLDFQEDETEVKAVLGTLLNLMEDPDKDVRIAFSGNIKYILESLNSED
GFIKELFVLRMKEAYTHAQISRSNELKDTLILTTGDIGRAAKGDLIPFALLHLLHCLLSK
SASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQTAEM
RKQHVAHHREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGK
QLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNEL
LLRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQLL
SSSVGIEDKKMALTSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCF
VRCLDHAYLGPLLSHVIVALLPLIQMQPKETAAIFHYLIIENRVAVQDFLHEIYFLPDHP
ELEKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLI
KYATDSETVEPVISQLVTVILKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGK
DFTFVTGVEDLSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQSNGPG
HQLWKRFPEHVREILEPHLNTRYKSSQKSTDWSGVTKPIYLSKLGNNFAEWSSSWAGYLI
TKVRDNLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCSQEDQQEVYAEIMAVLKHD
DQHAISTQDSASDLCQLSTQTVFSMLDHLTQWARHKFQALNAEKLAQNKPKGVSSVNFED
YQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQKHLGFLQKLYAAMHE
PDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYHGVVKSMLG
LGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTWSVRLG
QLLLSAKKRDTTAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEFIVRLHMLCELEHSLK
PLFHKFPGDSCNEDSLNWAARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMVGECWL
QSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGVELCFP
ENKSPTESKHMLIHGRATLLVGRFMEETANFESNAIMKKYKDVTLFLPEWEDGHFYLAKY
YDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDFGAKAYEWE
KGGRSDRLQMRNDLAKINSVLTEHTNRLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIA
KVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILTKAIHMKKSLEKFVGDATRLTDKLLEL
CNKSVDGSNSTLSMSTHFKMLKKLVEDPTFSEILIPLQSVMIPTLPSILGAHANHDPFPG
HWAYLAGFDDVVEILSSLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSLINKS
LRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVYMTGKELRQ
CMLPKSAALSEKLKVFQEILLPRHPPVFHEWFLRTFPDPTSWYSSRSAYCRSTAVMSMVG
YILGLGDRHGENILFDSFTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGT
EGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPPNETGEVVNEKA
KTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
NT seq 7911 nt   +upstreamnt  +downstreamnt
atgggtgaccacgggctggagctggcgtccatgattcccgccctgcgggagttgggcagt
gctactccagaggaatataatactgttgtgcagaaaccaagacaaattctctgccaattc
attgaccgaatacttacagatgtaaatgttgttgctctcgaacttgtaaagaaaactgac
actcagccgacctctgtgatgttacttgattttatccagcacatcatgaagtcttctcca
cttatgtttgtaaatgtgaatggaagccagggccaaaatgaggccaaagacagttgtatt
gaattcagtcattggatcattacaagacttttacggattgcagcaactccatcctgccac
atgctacacaagaaaatatgtgaagttatctgctcattattatttctttttaaaagcaag
aatcctgctatttttggggtactcacaagagaattactttatctttttgaagacttgatt
tacctccacaaaagaaatgcagtgggtgatgttatggaatggccagtggttgtcagtcga
tttttaagccgattggatgaacacatgggatgtttacagccagctcctttgcagttcatg
aacatgcaaaatgtagaatttattgaagtcactttattaatggttcttattcatattgtt
ccaactgtgttttttagacgacaagaattgttactgtggcagattggctgtgctctgcta
gagcatggtagtcccaagatcagatctttagcaattagccttttaactgagctctttgag
ctgggaggattaccagcacagccagccagcacctttttcagcctatttttggagttgcta
caacaccttataggaatggatgctgaccaactgaaattgtatgaagagccattgtcaaag
ctggtaaaaacactgttcccctttgaggcagaggcttatagaaatattgaacctgtttac
ttaaatgtgctgctggaaaaactccgagtcatgtttgaagatcgcgtgctcatgcggctc
aagtctgatttgctgaaagcagctctgtgccatttactgcagtatttcctcacatttgtg
ccagcggggtatgagtcggcgttacaggtcaggaaggtttatgtgactgatatttgtaga
gctcttgtagatgtcctcggagttcagacacatgtggggtatttgttgggaccattttat
gcagccttgaaaatggaaagtacggaaattattgagagaattcaatgtcaagctcaacag
gagaatctccgtggtagtaatgatggtgtgtcaccaaagaggcgtagactcagctcctct
ctcagctcttacaaaaggccatccagacagtctgaagaaattaatcatgtggatatggac
aaaaagagcatattatggaatgttctgaaacagaaagctgaatcccttcagatttccctt
gaatgtggtactctaaagaattctgttgctgaggcattagaaggaatcactattgtatta
cagctgactgctctctgcactgttcactgttctcatcaagacatggatggccataatgcc
aaggattgtcaacacaaatataagaagaaacctccagtagtaataacttggatgtctttg
gatttttatacaaaagtgcttaaaagctgtaagagtttgttagaatctgttcagaaacat
gaactggaattagtcatcgatagtgtggtgagaatttatgatgctttgatgtatatacaa
gtaaaaagttcatttcaagatcatgttctggaagagttatgtggaatgctctcacttcct
tggatttattcctattctgatgataactctttaaagatgaccacatttgctactaacctt
ctgcggttaagccagagggtttgggaaagttactctccacaggcacagtcacaatgcgtg
tttcttctgacactgtttccaaaaagaatattccttgactggagaacaacagtttataat
tgggccttgaagagctcccatgaagtaatccggactagttgtgttaaaggattttttatc
ttattgcagcaggagaattcttgtaatcaaattcccaagatgctaatagatagagtcaaa
gatgattctcacgtggtcaagaaagaatttgcttctgtccttggtcaacttgtctgtact
cttcatggcatgttttatttgacaagttcctcggtagagcctttctttggacctgtggac
ttgttctgtaagaacctgaaagccacttctcaacatgaatgttcatcttctcaagtaaaa
gcttccgtttgcaagccattccttttcctgctgactaaaaatacacctagtccagtaaaa
cttgctttcatagacaatctgcatcatctttgtaagcatcttgattttcaagaagatgaa
acagaggtaaaagcagttcttggcactttattaaatttgatggaagatccagacaaggat
gttagaatagcttttagtggaaatatcaagtatatattggaatctttgaactctgaagat
ggattcataaaagagctttttgtgttaagaatgaaggaagcatatacacatgcccagata
tcaaggagtaatgagctgaaggacaccttgattcttacaacaggggatattggaagggca
gcaaaaggagatttgataccttttgcactcttgcatttactgcattgcttgttgtctaag
tctgcatccgtctctggagcggcatacacagagatccgagcactagttgcagccaaaagt
gttaaactacagaattttttcagtcaatataagaaaccaatctgtcagtttttggtagaa
tctctccactccagtcagatgacagcactcccaagtactccttgccagactgctgagatg
cgaaaacaacatgttgctcatcacagagaaatggctttaaataccttatcagaaattgcc
aatgtttttgactttcctgatcttaatcgtttcctgacaaggacattacaagttctactt
cctgatctggccgccaaagcaagtcctgcagcatcggctctcatccgaactttagggaaa
caattaaatgtcaaccgtcgagagattttaataaataacttcaaatatattttttctcat
ttggtttgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaa
acagaaattgagttggggagcctgttaagacaggattttcaaggattgcacaatgaatta
ttgctgcgtattggagaacattatcaacaagttttcaatggtttgtcaatccttgcctca
tttgcatctagtgatgatccgtatcaaggaccacgagatatcacatcgcctgaactgatg
gctgattatttgcaaccgaaattgttgggcattctagccttttttaatatgcagttactg
agctccagtgttggtattgaagataaaaaaatggccttgactagtttgatgtctttgatg
aagttgatgggacctaagcatgttagttctgtgagagtaaagatgatgaccacactgaga
actggactgagattcaaggatgatttccctgagttatgctgcagagcatgggactgcttt
gttcgttgtctggaccacgcttacctgggacccctgctcagtcatgtcatagtggctttg
ctacctctcatacagatgcagcctaaagaaactgcggctatctttcactacctcatcatt
gaaaacagggttgccgtgcaagattttcttcatgaaatatattttctgcctgatcatcca
gaattagaaaagataaaagcagttctgcaggaatatagaaaggaaacctctgagagtact
gatcttcaaaccactctccagctctctatgaaagcaattcagcatgaaaatgtagatgtt
cgtattcatgctcttaccagcttgaaggaaaccttgtacaaaaaccaggaaaaactgata
aaatatgcaactgatagtgaaacagtggagcctgttatctcccagcttgtgacagtaatt
ttgaaaggctgccaagatgcaaactctcaagctcgcttgctctgtggggaatgtttagga
gaactgggagcaatagacccaggacgattagatttctcaacaacagaaactcagggaaaa
gattttacatttgtgactggagtagaagatttaagctttgcctatggattgctgatggag
ctaacaagagcttaccttgcgtatgccgataacagccgagcacaagattcagctgcttat
gccattcaggagttactttctatttatgactgtagagagatgcagagcaatggcccaggc
caccagttgtggaagagattccctgagcacgtccgagaaatattagaacctcatcttaat
actagatataagagttcccagaagtcaacagattggtctggagtaacgaagccaatttac
ttaagtaaactaggtaataactttgcagaatggtcatcatcttgggcaggttatcttata
acaaaggtccgggataatcttgccagtaaaatcttcacctgctgtagtataatgatgaag
catgatttcaaagtcaccatctatctccttccacatatcctagtatatgtcttgttgggt
tgtagtcaagaagatcagcaagaggtttatgcagaaattatggcagtacttaagcatgat
gatcagcatgccatcagtacccaggacagtgcatcggatctgtgccagttgagtacacag
actgtgttctctatgcttgaccatctcacccaatgggcaaggcacaaatttcaggcattg
aatgctgagaaacttgcacaaaacaaaccaaaaggagtatcaagtgtgaattttgaagac
tatcagagtgtaactcgttttctagacctcatacctcaggatactctggctgtagcctcc
tttcgttccaaagcatacacacgagccgtaatgcactttgagtcatttattacagaaaag
aagcaaaatattcaaaagcatcttggatttctacagaaattgtatgctgctatgcatgaa
ccagatggagtggctggagtaagtgcaattcgaaaagcagagccatcactgaaggaacag
attcttgagcatgaaagtattggcttgctgagggatgccactgcctgttatgacagggct
attcagctagaaccggaccagatcattcattatcatggtgtcgtgaagtccatgttaggt
cttggtcagctgtccactgtaatcacccaggtcaatggagtgcatgctaataggtctgaa
tggacagatgaattaaacacatacagagttgaagcagcttggaaactgtcacagtgggat
ttggtggaaaactacttggcagcagatgggaaatccacaacgtggagtgtcagactagga
cagctactgttatcagctaaaaagagggacaccacagctttctatgacacactgaaacta
gtgagagcagaacaaattgtacctctctcagctgcaagcttcgaaagaggctcctaccaa
cgaggatatgaatttattgtcaggttacacatgttgtgtgagttggagcacagcctcaaa
ccactttttcacaagtttccaggtgacagttgtaatgaagactctctgaactgggcagct
cgactagaaatgacccagaattcctacagagcaaaggagcctatcctggccctccggagg
gctttattaagtctcaacaaaaggcctgattacaatgaaatggttggagaatgctggcta
cagagtgccagggtagctagaaaggctgggcaccatcagacagcctacaatgctctcctt
aatgctggagagtcacgacttgccgaactctatgtggaaagggcgaagtggctgtggtcc
aagggtgatgttcaccaggcgcttattgttcttcaaaagggggttgaattatgttttcct
gaaaataaatccccaactgagagtaagcacatgttaatccatggtcgagctacactgctc
gttggccggtttatggaagaaacagctaactttgaaagcaacgcaattatgaagaaatat
aaggatgtgaccttgtttctgccagagtgggaagatgggcatttctaccttgccaagtac
tatgacaagttgatgcccatggtaacagataacaaaatggaaaagcaaggcgatctcatc
cgatatatagtcctacattttggaagatctcttcagtatggaaatcagttcatatatcaa
tcaatgccacgaatgttatcgctatggcttgattttggtgctaaggcatacgaatgggaa
aaaggtggtcgttctgatcgtctgcaaatgagaaatgatttggcaaaaataaatagtgta
ctcacagagcacacaaatcggttagcaccatatcagtttttgactgctttttcgcagttg
atctctcgaatttgtcattctcatgatgaagtttttgttgtcttgatggaaataatagcc
aaggtctttctggcctatcctcagcaagcaatgtggatgatgactgctgtgtcaaagtct
tcttatcccatgcgtgtgaacagatgcaaggaaattcttaccaaagctatccatatgaaa
aagtctttagaaaagtttgtcggagatgcaactcgcctaacagacaagctactagagtta
tgcaacaaatcggttgatggaagtaattctacattgagcatgagcactcactttaaaatg
cttaaaaagctggtagaagacccaacatttagtgaaatcctcattcctttgcagtcagtc
atgatacctactcttccatcaattctgggtgcccatgctaatcatgacccctttcctggg
cattgggcctatcttgcaggcttcgacgatgtggtagaaattctttcttctcttcagaaa
ccaaagaaaatctccttaaagggctcagatggaaaattctatatcatgatgtgtaaacca
aaagatgatttgagaaaagactgtagactaatggaatttaattctttgattaacaagagc
ttaagaaaagatgcagaatcacgtcgaagagaacttcatatccgaacatatgcagttatt
ccactgaatgatgagtgtgggattattgaatgggtgaacaacactgctggcttgagacct
attctgaccaaactatacaaagaaaagggagtgtatatgacaggaaaggaacttcgccag
tgtatgctaccaaagtcagcagctttatctgaaaaactcaaagtattccaagaaatactc
ctgcccaggcaccctcctgtttttcatgagtggtttctaagaacattccctgatcctaca
tcatggtacagcagtaggtccgcatactgccgttctactgcggtcatgtcaatggttggc
tatatcctggggcttggagaccgtcatggtgaaaacattctttttgattctttcactggt
gaatgtgtacatgtagacttcaactgtctttttaataagggagaaacttttgaagttcca
gaaattgtaccatttcgactgactcataatatggttaatggaatgggtcctatgggaaca
gagggtctgtttcgaagagcatgtgaagttacactgagactgatgagggatcagcgcgaa
cctttaatgagtgtcttaaagacttttctgcatgatcctctcgtggaatggagtaaacca
gtgaaaggacactccaaagcaccaccgaatgaaaccggggaagttgtcaatgagaaggct
aagacccatgttcttgacattgaacaacgactacaaggtgtaatcaagacccggaataga
gtaacagggctgccgttatctattgaaggacatgtgcattatctcatacaagaagctact
gatgaaaacttactatgtcagatgtaccttggttggaccccatatatgtaa

DBGET integrated database retrieval system