KEGG   Rattus norvegicus (rat): 301965
Entry
301965            CDS       T01003                                 

Gene name
Tert
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    301965 (Tert)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    301965 (Tert)
   05226 Gastric cancer
    301965 (Tert)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    301965 (Tert)
   05165 Human papillomavirus infection
    301965 (Tert)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    301965 (Tert)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     301965 (Tert)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    301965 (Tert)
   Telomerase complex (fungi)
    301965 (Tert)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 301965
NCBI-ProteinID: NP_445875
RGD: 70494
Ensembl: ENSRNOG00000025327
UniProt: Q673L6
Position
1
AA seq 1125 aa
MPRAPRCPAVRSLLRSRYREVWPLATFVRRLGLEGSRLVQPGDPKVFRTLVAQCLVCVPW
GSQPPPADLSFHQVSSLKELVSRVVQKLCERGERNVLAFGFALLNGARGGPPMAFTTSVH
SYLPNSVTESLCVSGAWMLLLSRVGDDLLVYLLSHCALYLLVPPSCAYQVCGSPLYQICA
TTDTWSSVPAGYRPTRPVGGNFTNLGSAHQIKNSGHQEAPKPQALPSRGTKRLLSLTSTN
VPSAKKARFEPALRVDKGPHRQVVPTPSGKTWAPSPAASPKVPPAAKNLSLKGKASDPSL
SGSVCCKHKPSSSSLLSSPPQDAEKLRPFTETRHFLYSRGGGQEELNPSFLLNSLPPSLT
GARRLVEIIFLGSRPRTSGPFCRTRRLPRRYWQMRPLFQQLLMNHAKCQYVRFLRSHCRF
RTANQRVPDAMDTSPSHLTSLLRLHSSPWQVYGFLRACLRELVPAGLWGTRHNERRFLKN
VKKFISLGKYAKLSLQELMWRVKVEDCHWLRSSPEKDTVPAAEHRLRERILAMFLFWLMD
TYVVQLLRSFFYITETTFQKNRLFFYRKSVWSKLQSIGIRQQLERVQLRELSQEEVKHHQ
DTWLAMPICRLRFIPKLNGLRPIVNMSYGMDTRAFGKKKQTQCFTQSLKTLFSVLNYERT
KHPNLMGASVLGTSDSYRIWRTFVLRVRALDQTPRMYFVKADVTGAYDAIPQDKLVEIVA
NIIRRSESMYCIRQYAVVQKDSQGQVHKSFRRQVSTLSDLQPYMGQFTKHLQDSDASALR
NSVVIEQSISMNETGSSLLHFFLRFVRHSVVKIDGRFYVQCQGIPQGSSLSTLLCSLCFG
DMENKLFAEVQQDGLLLRFVDDFLLVTPHLAHAKAFLSTLVHGVPEYGCMINLQKTVVNF
PVETGALGGAAPHQLPAHCLFPWCGLLLDTRTLEVFCDYSGYGRTSIKMSLTFQGVSRAG
KTMRYKLLSVLRLKCHGLFLDLQVNSLQTVCINIYKIFLLQAYRFHACVIRLPFGQHVRK
NHAFFLGIISNLASCCYAILKVKNPGVSLRAKGAPGSFPPEATRWLCYQAFLLKLAAHSV
TYKCLLGPLRTAQKQLCRKLPEATMTLLKTAADPALSTDFQTILD
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgccccgcgctcctcgttgccccgccgtgcgctctctactgcgcagccgatatcgggag
gtgtggccgctggcgacctttgtgcggcgcctggggcttgagggcagtcggcttgtgcaa
cccggggacccgaaggtcttccgcacgttggttgcccagtgcctagtgtgcgtgccctgg
ggctcacagccgccacctgctgacctttccttccaccaggtgtcatccctgaaagagctg
gtgtccagggttgtgcagaaactttgcgagcgcggtgagaggaatgtgctggcttttggc
tttgcactgcttaacggggccagaggtgggcctcccatggccttcacgaccagcgtgcat
agctacttgcccaactcggttactgagtccctgtgtgtcagtggtgcatggatgctactg
ttgagccgagtgggcgacgacctgctggtctacctgctgtcgcactgtgcgctctacctg
ctggtgccccccagctgtgcctaccaggtgtgcgggtcacccctgtaccaaatttgtgcc
accacggatacctggtcctctgtgcccgctggttacaggcccactcgacccgtgggcggg
aatttcactaaccttgggtccgcacaccagatcaaaaacagtggtcaccaggaagcacca
aaaccccaggccttgccatcacgaggtacgaagaggcttctgagtctcaccagtacaaac
gtgccttcagctaagaaggccaggtttgaacctgccctgagagtggataagggaccccac
aggcaggtggtaccaaccccatcaggcaaaacatgggcgccaagtcctgctgcgtccccc
aaggtgcctcctgcagcgaaaaacttgtctttgaaaggaaaggcatctgacccgagtctc
tctgggtcggtgtgctgtaaacacaagcccagctcctcgtccctgctgtcatcaccaccc
caagatgctgaaaagctcaggccattcactgagaccagacatttcctttactccagggga
ggtggccaagaggagctaaatccctcattcctactcaacagcctcccgcctagcttgacc
ggggccaggagactggtggagatcatctttctgggctcaaggcctaggacatcaggacca
ttctgcaggacccgccgcctgccccgtcgatactggcagatgcgacccctattccagcag
ctgctcatgaaccacgcaaagtgccaatatgtcagattcctccggtcgcactgcagattt
cgaacagcaaaccagcgggtgccggatgccatggacaccagcccatcccacctcacgagt
ttgctccggttacacagcagcccctggcaggtatacggctttcttcgggcctgcctccgc
gagctggtgcctgccggtctctggggcaccaggcacaatgagcgccgcttcttaaagaac
gtgaagaagttcatctcgttggggaagtacgccaagctatccctgcaggaactgatgtgg
agggtgaaagtggaggactgccactggctccgcagcagcccagagaaggacactgtccct
gccgcagagcaccgtctgagggagaggatccttgccatgttcctgttctggctaatggac
acatatgtggtacagctgctgaggtcattcttctacatcacagagaccacgttccagaag
aaccgccttttcttctaccgtaagagtgtgtggagcaagctgcagagcattggaatcagg
caacagcttgagagagttcagctacgggaactgtcacaagaggaggtcaagcatcaccag
gacacttggctggccatgcctatctgcagattgcgcttcatccccaagctcaatggtctc
cggcccattgtgaacatgagttatggcatggacaccagagcttttggcaaaaagaagcag
acccagtgtttcactcagagtctcaagactttgttcagcgtgctcaactacgagcggacc
aaacatcctaaccttatgggtgcttcagtactgggtacgagtgacagctacaggatctgg
cggaccttcgtgctgcgtgtgcgtgctctggaccagacacccaggatgtactttgttaag
gcagatgtgacaggggcctatgatgccatcccccaggacaagctcgtggaaattgtcgcc
aatataatcaggcgctcagagagcatgtactgtatccgccagtatgcagtggttcagaaa
gatagccaaggccaagtccacaagtccttcaggagacaggtctccaccctctctgacctc
cagccatacatgggccagttcaccaagcatctgcaggactcagatgccagtgcactgagg
aactctgttgtcatcgagcagagcatctccatgaatgagactggcagtagcctgctccac
ttcttcctgcgctttgtccgtcacagtgtcgtgaagatcgatggcaggttctatgtgcaa
tgccagggcatcccccagggctccagcctgtccaccctgctctgcagtctgtgtttcgga
gacatggagaacaagctgtttgccgaggtgcagcaggacggcttgcttttacgttttgtc
gatgactttctgttggtgacacctcacctggcccatgcaaaagcctttctcagcaccctg
gtccatggcgtgcccgagtatggctgcatgataaacttgcagaagacagtggtgaacttc
cctgtggagaccggcgccctgggaggtgcagccccgcaccagctgcctgctcactgcctg
tttccctggtgtggcttactgctggacactcggactttggaagtattctgtgactactca
ggttacggacggacctcaattaagatgagcctcaccttccagggtgtctccagggccggg
aagaccatgcggtacaagctcttgtcagtcttgcggttgaagtgtcatggtctgtttcta
gacttgcaggtgaacagcctgcagacagtctgcatcaatatatacaagatcttcctgctt
caggcctacaggttccatgcatgtgtgattcggcttccctttggccagcatgttaggaag
aaccatgcattctttctgggcatcatctccaacctagcatcctgctgctacgccatcctg
aaggtcaagaatccaggagtgtcactaagggccaagggtgcccctggctcctttccgccc
gaggccacacgttggctctgctaccaagccttcctgctcaagctggctgctcattctgtc
acctacaagtgtctcctgggacctcttaggacagcccaaaaacagctgtgccggaagctc
ccagaggcaacaatgaccctccttaagactgcagctgacccagccctaagcacagatttt
cagaccattttggactaa

DBGET integrated database retrieval system