KEGG   Rattus norvegicus (rat): 303251
Entry
303251            CDS       T01003                                 

Gene name
Dvl2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04330  Notch signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303251 (Dvl2)
   04330 Notch signaling pathway
    303251 (Dvl2)
   04390 Hippo signaling pathway
    303251 (Dvl2)
   04150 mTOR signaling pathway
    303251 (Dvl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    303251 (Dvl2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    303251 (Dvl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303251 (Dvl2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    303251 (Dvl2)
   05226 Gastric cancer
    303251 (Dvl2)
   05217 Basal cell carcinoma
    303251 (Dvl2)
   05224 Breast cancer
    303251 (Dvl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    303251 (Dvl2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303251 (Dvl2)
   05022 Pathways of neurodegeneration - multiple diseases
    303251 (Dvl2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    303251 (Dvl2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 303251
NCBI-ProteinID: NP_001165527
Ensembl: ENSRNOG00000017915
UniProt: D3ZB71
Position
10
AA seq 736 aa
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDSARLPCFNGRVVSWLVSSESPQPETAPPAHESRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPG
VPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDSMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYSYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESELSSRGGSLRRGGEPGGTGDGGPPPSRGSAGGTPNLRA
LPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcgcggggggcggtggtgtaggcgagacgaaggtgatttaccatctg
gatgaagaagagactccttacctggtgaagatccctgtcccggcggagcgcatcacgctc
ggcgatttcaagagcgttttgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagagatctctgacgacagtgcccgcctaccttgc
ttcaatggaagggttgtctcctggctggtgtcatcagagagcccccagcctgagacagcg
ccccctgcccatgagtctcggacagaactggttcctccacctccaccattaccccctttg
ccaccagaaaggaccagtggcattggggactcaaggcctccatccttccaccctaatgta
tccagtagccatgaaaatctagagcctgagacagaaactgaatccgtcgtatcactgaga
cgagaccgacctaggaggagagacagcagtgagcatggcgctggtggccacaggcctggc
gtcccctcaaggctggagcgccacctggctgggtatgagagctcttccaccctcatgacc
agcgaactggaaagtaccagcttaggagattcagatgaggatgacagcatgagtaggttc
agcagctccactgagcagagcagtgcctcccgcctcctcaagcgccaccgaaggcgaagg
aagcagcggccgccacgcatggagaggacctcatccttcagcagtgtcacagattctaca
atgtctctcaacatcatcacagtcacactcaacatggagaaatacaacttcctgggtatc
tccattgtgggccaaagtaacgagcgtggtgacggaggcatctatataggctccatcatg
aaagggggagcggtggctgcagatgggcggatcgagcctggagacatgcttttgcaggta
aacgacatgaactttgagaacatgagcaatgacgatgctgtgcgggtgctgagagacatt
gtacacaagccaggccccatcgtgctcaccgtggccaagtgttgggatccctctccccag
gcctacttcaccctcccccgaaatgagcccatacagccaattgatccagctgcctgggtg
tcccattcagctgcgctaaccggtgccttccctgcttaccccggctcttcatctatgagc
actatcacatctggctcctctctgcctgatggctgtgaaggccggggtctctctgtccac
atggacatggcctctgtgaccaaggccatggcagccccagagtctgggcttgaagtccgg
gaccgcatgtggctcaagatcaccatcccaaacgcctttctaggctcggatgtggtagac
tggctgtatcaccatgtggaaggctttcctgagcgccgggaggcccgcaagtacgccagt
gggctgttgaaggcgggactcatccggcacactgtcaacaagattactttctctgagcag
tgctactatgttttcggggacctcagtggtggctgcgagagttacctagttaacctgtct
ctgaatgacaacgatggttccagtggggcttcagaccaggatactctggctcctcttcct
ggagctactccctggcccctgctgcctaccttctcctaccaatacccagccccgcacccc
tacagcccacagcctccgccctatcatgagctttcgtcctacagctatggcggaggcagt
gccagcagccagcacagtgaggggagccggagcagtgggtcaacaagaagtgatgggggg
gccgggcgcacagggaggcctgaggaacgggcccctgagtcaaagtctggcagtggcagt
gagtctgaactctccagccggggaggcagccttcggcggggtggggaacctggtgggact
ggtgatggtggaccccctccatccaggggctcagcaggtggtactcctaacctccgagct
ctcccaggcctccatccctatggacctccacctggcatggctctcccctataaccccatg
atggtagtcatgatgcctccacccccaccccctgtctcgacagcagtacagccccctggt
gcccctccagtcagagacctgggctctgtgcccccagaactgacagctagccgtcagagc
ttccacatggccatgggcaaccccagtgagttttttgtagatgttatgtag

KEGG   Rattus norvegicus (rat): 303811
Entry
303811            CDS       T01003                                 

Gene name
Dvl3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04330  Notch signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    303811 (Dvl3)
   04330 Notch signaling pathway
    303811 (Dvl3)
   04390 Hippo signaling pathway
    303811 (Dvl3)
   04150 mTOR signaling pathway
    303811 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    303811 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    303811 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303811 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    303811 (Dvl3)
   05226 Gastric cancer
    303811 (Dvl3)
   05217 Basal cell carcinoma
    303811 (Dvl3)
   05224 Breast cancer
    303811 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    303811 (Dvl3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303811 (Dvl3)
   05022 Pathways of neurodegeneration - multiple diseases
    303811 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    303811 (Dvl3)
SSDB
Motif
Pfam: Dsh_C Dishevelled PDZ DEP DIX PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 303811
NCBI-ProteinID: NP_001100551
RGD: 1308834
Ensembl: ENSRNOG00000001708
Position
11
AA seq 668 aa
MDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGG
IGDSRPPSFHPHASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTTKGERRR
EPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSR
IERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA
ADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLP
RSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSI
HSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYA
SNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPG
AAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYAGGSASSQHSEGSRSSGSNRSGSDRRKE
KDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHH
THPSYGPPGVPPLYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNP
SEFFVDVM
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggacgacgattttggagtggtgaaggaagagatctcggatgacaatgccaagctgccc
tgcttcaatggccgggtggtgtcctggctggtatcggccgagggctcacacccagagcca
gcccctttctgtgctgacaacccctcagagctgcctccttcaatggaacgcacaggaggc
atcggtgactctcggcccccgtccttccaccctcatgctagtgggggcagccaggagaac
ttggacaatgacacagagaccgactccttggtatctgcccaacgagagcggcccagacgg
agggatggccctgagcacgcagcccgcctcaatggaaccacaaagggcgagcggcgacgg
gagccaggtggctatgacagttcatctaccctcatgagcagcgagctggagactaccagt
ttctttgattcagatgaggatgactccaccagcaggttcagcagctccacagaacagagc
agtgcctcacgcctaatgagaagacacaagcggcggcgacggaagcagaaggtctcccgg
attgagcggtcctcctccttcagcagcatcacagactccactatgtctctcaacatcatc
acagtgactctcaacatggaaaagtataacttcttgggcatctccattgtgggccagagc
aatgagcgaggtgatgggggcatctacattggctccatcatgaagggtggggcagtggcg
gctgatggacgcattgagccgggagatatgctgttgcaggtaaatgagatcaacttcgag
aacatgagtaatgatgacgcagtcagagtgcttcgggagatcgtgcacaaaccagggccc
atcactctgactgtagccaagtgctgggacccaagtcctcgtggctgcttcacattaccc
cggagtgagcccatccgtcccattgaccctgcagcctgggtctcccacactgcagccatg
acaggaaccttccctgcctatggcatgagcccctccttaagcaccatcacctccaccagc
tcctccatcaccagctccatccccgacacagaacgcctagatgatttccacctctccatc
cacagtgacatggcggccatcgtaaaagccatggcctcccccgagtcagggctggaggtc
cgagaccgcatgtggctcaagattaccattcccaatgctttcatcggctcagatgtggtg
gactggctgtatcacaatgtggaaggattcaccgaccggcgggaggcccgcaagtacgct
agcaacctgctgaaggctggattcatccgccacacggtcaacaagatcacgttctctgag
cagtgctactacatctttggtgacctctgtggcaacatggccaacctatcgctgcacgac
catgatggctccagtggtgcctctgaccaggacacactggctcctctgccgcacccaggg
gctgccccttggcctatggctttcccttaccagtacccaccacctccgcacccgtacaac
ccacacccaggcttcccggagctgggctacagctacgctgggggcagcgccagcagtcag
cacagtgaaggtagtaggagcagtggctccaaccgaagtggcagcgaccggcgcaaggag
aaggacccaaaagctggggactcaaagtcaggtggtagcggcagcgagtcagaccacact
acacgcagcagtctgcgggggccacgggagcgggcaccaagcgagcgctcaggcccagcg
gccagcgagcacagccaccgcagtcatcattcactgaccagtagcctgcgcagccaccac
acacacccaagctatggcccacccggagtgccccctctctatggtcccccgatgctgatg
atgaccccaccgcctgcagccatggggcccccaggagcccctccagggcgtgacctggcc
tcggtgcccccggaactgacggccagcagacagtccttccgcatggcaatgggaaacccc
agtgagttctttgtggatgtgatgtga

KEGG   Rattus norvegicus (rat): 83721
Entry
83721             CDS       T01003                                 

Gene name
Dvl1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1
  KO
K02353  segment polarity protein dishevelled
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04330  Notch signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    83721 (Dvl1)
   04330 Notch signaling pathway
    83721 (Dvl1)
   04390 Hippo signaling pathway
    83721 (Dvl1)
   04150 mTOR signaling pathway
    83721 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83721 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    83721 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83721 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    83721 (Dvl1)
   05226 Gastric cancer
    83721 (Dvl1)
   05217 Basal cell carcinoma
    83721 (Dvl1)
   05224 Breast cancer
    83721 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    83721 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83721 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    83721 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    83721 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 83721
NCBI-ProteinID: NP_114008
RGD: 620632
Ensembl: ENSRNOG00000019423
UniProt: Q9WVB9
Position
5
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRELGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSG
SESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaaaatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtagctcccgagcgcgtcacgctggcagacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaag
gaggagatcttcgacgacaatgccaagttgccctgcttcaatggccgtgtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catccaaatgttgccagtagccgagatggaatggacaatgagacaggcacagagtcaatg
gtcagtcaccggcgggagcgagcccgacgtcgaaaccgtgatgaggctgcccggaccaat
gggcacccaagaggggaccggcggcgggagctgggactacctccagacagtgcgtccact
gtactgagcagtgagcttgaatctagcagctttattgactcagatgaggaggacaacacg
agccggctgagcagctctacagagcagagtacctcctctcggctaattcgtaagcacaaa
tgccgtcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagcatc
accgactctaccatgtccctgaacatcatcactgtcacgctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggggctgtggctgctgatggccgcattgagccaggcgacatg
ttgctgcaggtgaatgatgtcaactttgagaacatgagcaacgatgatgccgtgcgggtg
cttcgggagatcgtatcccagacggggcccatcagtctcacagtggccaagtgctgggac
ccaacccctcggagctacttcaccatcccaagggctgacccagtgcgacccatcgacccg
gctgcctggctgtcccacacagcagcactgaccggtgctctgccccgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagcttgaggaggcaccactgactgtgaagagtgacatgagtgccattgtccgc
gtcatgcagttgccagactcgggactggagatccgggaccgcatgtggcttaagatcacc
attgccaatgctgtcattggggcggatgtggtggactggctgtacacacacgtggagggc
ttcaaggagcgaagggaggcgaggaagtatgccagcagcatgctgaagcatggtttcctg
cggcacacggtgaacaagatcactttctctgagcagtgctactatgtctttggtgacctg
tgcagcaacctcgcatccctgaacctcaacagtggctccagtggagcctcagatcaggac
acactggccccactgccccacccatctgtaccctggcccttgggtcaaggctatccctac
cagtacccaggacccccgccctgcttcccacctgcttaccaggaccctggcttcagctat
ggcagtggcagtgctgggagtcagcagagtgaagggagcaagagcagtgggtccacacgg
agcagccatcgcaccccaggccgagaggagcgccgggcaactggagctgggggtagtggc
agtgaatcagaccacacagtaccaagtgggtctggtagcactggctggtgggagcggcct
gtcagccagcttagccgtggcagtagccctcgaagtcaggcttcagctgttgccccaggg
ctccctccactgcacccccttaccaaggcctatgcagtagtgggtgggccacctggaggg
ccacctgtccgggagctggctgctgttcctccagaacttacaggtagccgccagtccttc
caaaaggccatgggaaacccctgtgagttctttgtggacatcatgtga

DBGET integrated database retrieval system