KEGG   Rattus norvegicus (rat): 303285
Entry
303285            CDS       T01003                                 

Gene name
Traf4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    303285 (Traf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    303285 (Traf4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    303285 (Traf4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-Nse zf-TRAF_2 zf-RING_2 zf-RING_6 zf-C3HC4_4 MATH zf-rbx1
Other DBs
NCBI-GeneID: 303285
NCBI-ProteinID: NP_001100487
RGD: 1306708
Ensembl: ENSRNOG00000013169
UniProt: B1WC90
Position
10
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLK
DSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccactg
tgcgggaaacccatgcgcgagcctgtgcaggtgtccacttgcggccaccgcttctgcgac
acctgcctgcaggagttcctcagtgaaggagtcttcaaatgccctgaagaccagcttcct
ctggactatgccaagatctacccggacccagagctggaggtgcaggtgttaggcttggct
atacgctgcatccacagtgaggagggctgccgctggagcgggccacttcgtcacctacag
ggccacttgaacacttgcagcttcaatgtagtcccctgcccgaatcgctgcccggccaag
ctgagccggcgcgacctgcccgcccacctgcagcacgactgccctaagcgccgcctcaag
tgtgaattctgtggttgtgacttcagtggggaggcctacgagagtcacgagggtgtgtgc
ccccaagagagtgtgtactgtgagaacaagtgtggtgcccgcatgatgaggcgactgttg
gcccagcacgccacttctgagtgccccaagcgcacccagccctgtgcctactgtaccaag
gagtttgtttatgacaccatccagagccaccagtaccagtgcccacgcctgcctgttccc
tgccccaaccagtgtggagtgggcactgtggcccgggaggacctgcccacccatctgaag
gatagctgcagcactgccttcgtgctctgccctttcaaagagtctggctgcaagcacagg
tgccctaagctggcaatgggacgtcatgtggaggaaagtgtaaagccacatctggctatg
atgtgcgccctggtgagccggcagcggcaagagctgcaggagctgcgcagagagctggag
gagctatctgtgggtagtgatggagtgctcatctggaagatcggcagctatgggcgtcgc
ctacaggaggccaaggccaagcctaacctggagtgcttcagcccagccttctatacacat
aagtacggttacaagctgcaggtgtctgcgttccttaacggcaatggcagtggggagggt
acgcatctctccatctacatccgtgtgctgccaggcgcctttgacaatctcctcgagtgg
ccttttgcacgacgggtcaccttctccctgctggatcagagtgacccaggtttggctaag
ccacagcatgtcacggagaccttccaccctgatccaaactggaagaacttccagaagcct
ggcacttggcgaggttccctggatgagagttctctgggctttggctaccccaaattcatt
tcccaccaggacatccgaaaacgaaattacgtgcgggatgatgcagttttcatccgtgcc
tctgtcgaactgccccggaagatcctcagctga

KEGG   Rattus norvegicus (rat): 311245
Entry
311245            CDS       T01003                                 

Gene name
Traf6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04140  Autophagy - animal
rno04144  Endocytosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    311245 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    311245 (Traf6)
   04064 NF-kappa B signaling pathway
    311245 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    311245 (Traf6)
   04140 Autophagy - animal
    311245 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    311245 (Traf6)
   04621 NOD-like receptor signaling pathway
    311245 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    311245 (Traf6)
   04657 IL-17 signaling pathway
    311245 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    311245 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    311245 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311245 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    311245 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    311245 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    311245 (Traf6)
   05161 Hepatitis B
    311245 (Traf6)
   05160 Hepatitis C
    311245 (Traf6)
   05171 Coronavirus disease - COVID-19
    311245 (Traf6)
   05162 Measles
    311245 (Traf6)
   05168 Herpes simplex virus 1 infection
    311245 (Traf6)
   05169 Epstein-Barr virus infection
    311245 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    311245 (Traf6)
   05135 Yersinia infection
    311245 (Traf6)
   05133 Pertussis
    311245 (Traf6)
   05152 Tuberculosis
    311245 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    311245 (Traf6)
   05140 Leishmaniasis
    311245 (Traf6)
   05142 Chagas disease
    311245 (Traf6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    311245 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    311245 (Traf6)
   04121 Ubiquitin system [BR:rno04121]
    311245 (Traf6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     311245 (Traf6)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    311245 (Traf6)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    311245 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX DUF4455 Tropomyosin_1 PspA_IM30 U-box UPF0242 zf-RING_11 DUF16 Spc29 Filament EzrA TACC_C Phage_GP20 TMF_DNA_bd ADIP Sina
Other DBs
NCBI-GeneID: 311245
NCBI-ProteinID: NP_001101224
RGD: 1306853
Ensembl: ENSRNOG00000004639
UniProt: B5DF45
Position
3
AA seq 530 aa
MSLLNCENSCASSQSSSDCCAAMANSCSAAMKDDSVSGCVSTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQCQRFFQKCQINKHIIE
DCPRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPV
PCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRGCRPED
PNYEETVKQLEGRLVRQDHQIRELTAKMETQSMHVSELKRTIRSLEDKVAEMEAQQCNGI
YIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVH
TMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFG
YVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtctcttaaactgtgaaaacagctgtgcgtccagccagtcttcaagcgactgctgt
gctgccatggccaactcctgcagtgctgccatgaaagatgacagtgtgagtggctgtgtc
agcacggggaacctgtccagctccttcatggaggagatccagggatatgatgtggagttt
gacccacctttggaaagcaagtatgagtgccccatctgcttgatggctttacgggaagca
gtgcaaacaccatgtggccacaggttctgcaaagcctgcatcaccaagtccataagggat
gcaggtcacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcctgac
aattttgcaaagcgagagattctttccctgacggtaaagtgtccaaataaaggctgtgtg
caaaagatggagctgagacatctcgaggatcatcaagtacattgtgaattcgctctagtg
atttgtccccaatgccaacgttttttccaaaagtgccagattaataaacacattatcgag
gattgtcccaggagacaggtttcttgtgtaaactgtgctgtgcccatgccgtatgaagag
aaagagatccacgatcaaagctgtcctctggcaaatatcatctgtgaatactgtggtaca
atcctcataagagaacagatgcctaatcattatgatctagactgcccaacagctccagtc
ccctgcacattcagtgtgtttggctgtcacgaaaagatgcagaggaatcacttggcacgg
cacttgcaagagaacacccagttgcacatgagactgttggcccaggctgttcataatgtt
aacctctctttgcggccatgcgatgcctcctctccatcccggggatgtcgtcctgaggac
ccaaattatgaggaaacggtcaaacagttggaggggcgcctagtaagacaggaccatcaa
atccgggagctgaccgccaaaatggaaacgcagagcatgcatgtgagcgagctcaagcgg
accattcgaagcctcgaggacaaagttgccgagatggaagcacagcagtgtaatggcatt
tacatttggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaagacct
gtggtcattcatagccctggattctacacaggcagacctgggtacaagctgtgcatgcgc
ctgcacctccagctaccgacggctcagcgctgtgcaaactacatttccctctttgtccac
acaatgcaaggagagtatgacagccacctcccctggcccttccagggtacaatacgcctc
acgatccttgatcagtctgaagcagtaataaggcaaaaccacgaagaggtcatggatgct
aagccagaactgcttgcctttcagcggcccaccatcccacggaaccccaaaggttttggc
tatgtgacattcatgcacctggaagccttaagacagggaaccttcatcaaggatgatacg
ttattagtgcgctgtgaagtctctacccgctttgacatggggggccttcggaaggagggg
ttccagccacggagtactgatgcaggcgtgtag

KEGG   Rattus norvegicus (rat): 311786
Entry
311786            CDS       T01003                                 

Gene name
Traf2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04071  Sphingolipid signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    311786 (Traf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    311786 (Traf2)
   04064 NF-kappa B signaling pathway
    311786 (Traf2)
   04668 TNF signaling pathway
    311786 (Traf2)
   04071 Sphingolipid signaling pathway
    311786 (Traf2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    311786 (Traf2)
   04217 Necroptosis
    311786 (Traf2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    311786 (Traf2)
   04622 RIG-I-like receptor signaling pathway
    311786 (Traf2)
   04657 IL-17 signaling pathway
    311786 (Traf2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    311786 (Traf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    311786 (Traf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311786 (Traf2)
   05203 Viral carcinogenesis
    311786 (Traf2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    311786 (Traf2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    311786 (Traf2)
   05160 Hepatitis C
    311786 (Traf2)
   05168 Herpes simplex virus 1 infection
    311786 (Traf2)
   05163 Human cytomegalovirus infection
    311786 (Traf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    311786 (Traf2)
   05169 Epstein-Barr virus infection
    311786 (Traf2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    311786 (Traf2)
   05135 Yersinia infection
    311786 (Traf2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    311786 (Traf2)
   05014 Amyotrophic lateral sclerosis
    311786 (Traf2)
   05016 Huntington disease
    311786 (Traf2)
   05017 Spinocerebellar ataxia
    311786 (Traf2)
   05022 Pathways of neurodegeneration - multiple diseases
    311786 (Traf2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    311786 (Traf2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    311786 (Traf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    311786 (Traf2)
   04121 Ubiquitin system [BR:rno04121]
    311786 (Traf2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     311786 (Traf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     311786 (Traf2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    311786 (Traf2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf_C2HC_14 zf-ACC zf-C3HC4_4 PIN_9 MATH
Other DBs
NCBI-GeneID: 311786
NCBI-ProteinID: NP_001101285
RGD: 1310457
Ensembl: ENSRNOG00000006238
UniProt: B5DFH7
Position
3
AA seq 497 aa
MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACRNILRRPFQAQCGHRYCSFCLTS
ILSSGPQNCAACVHEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKE
YESCHEGLCPFLLTECPACKGLVRLSEKKHHTEQECPKRSLSCQHCRAPCSHADLELHYE
VCPKFPLTCDGCGKKISQEKLQDHVRTCSKCRVLCRFHAIGCSELVETEDLQDHELQRLR
EHLALLLSSFLESQASQNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACS
RQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFARK
RQEAIAGRTPAIFSPAFFTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQW
PFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKIEAKNSY
VRDDAIFIKAIVDLTGL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggctgcagccagtgtgacttcccctggctccctagaactgctgcagcctggcttctcc
aagacccttctggggacaaggttagaagccaagtacctgtgttcagcctgcagaaacatc
ctgcggaggccattccaggcccagtgtgggcaccgctactgctccttctgcctgaccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgaaggcctgtatgaagaa
ggcatttctattttagagagcagttcggcctttccagataacgctgcccgcagagaggtg
gagagcctgccagccgtctgtcccaatgatggatgcacctggaaggggaccttgaaagaa
tacgagagctgccacgaaggactgtgcccattcctgctgactgagtgccctgcgtgtaaa
ggcctggttcgcctcagcgagaagaagcaccacactgagcaggaatgccccaaaaggagc
ctgagctgccagcactgcagggcaccctgtagccatgcagacctggagctacactacgag
gtctgccccaagtttcccttaacctgtgatggctgtggcaagaagatctctcaggagaag
cttcaggaccatgtcagaacgtgcagtaagtgccgggtcctctgcaggttccacgccatc
ggctgctcggagctggtggagactgaggacctgcaggaccacgagctgcagcgtctacgg
gaacatctggccctactgctgagctcgttcctggagtcccaagcctcacagaaccaggtg
gggccagagctgttacagcggtgccagattttggagcagaagatagccacctttgagaac
attgtctgcgttttgaaccgggaggtagagagggtagcagtgactgcagaggcttgtagc
cggcagcaccgtctggaccaggacaagattgaggccctaagcaacaaggtgcagcagctg
gagaggagcatcggcctcaaggacctggccatggctgacctggagcagaaggtctcagag
ttggaggtgtccacctatgatggggtcttcatctggaagatctccgacttcgccagaaaa
cgtcaggaagccatcgctggccggacacctgctatcttctccccagccttcttcacaagc
agatatggctacaagatgtgtctccgggtctacttgaatggcgacggcactgggcgggga
actcatctgtctctcttcttcgtggtgatgaaaggtcccaatgatgctctcttacaatgg
ccttttaatcagaaggtgactttgatgttgctggaccataacaaccgagagcatgtgatc
gacgcattcaggcctgatgtaacttcgtcctccttccagaggcctgtcagtgacatgaat
atcgccagtggctgccccctcttctgcccggtgtccaagatagaggccaagaattcctac
gtgcgggatgacgccatcttcatcaaagctattgtggacctgacaggactctag

KEGG   Rattus norvegicus (rat): 362788
Entry
362788            CDS       T01003                                 

Gene name
Traf3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    362788 (Traf3)
   04668 TNF signaling pathway
    362788 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    362788 (Traf3)
   04621 NOD-like receptor signaling pathway
    362788 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    362788 (Traf3)
   04657 IL-17 signaling pathway
    362788 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362788 (Traf3)
   05203 Viral carcinogenesis
    362788 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    362788 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    362788 (Traf3)
   05160 Hepatitis C
    362788 (Traf3)
   05171 Coronavirus disease - COVID-19
    362788 (Traf3)
   05164 Influenza A
    362788 (Traf3)
   05162 Measles
    362788 (Traf3)
   05168 Herpes simplex virus 1 infection
    362788 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    362788 (Traf3)
   05169 Epstein-Barr virus infection
    362788 (Traf3)
   05165 Human papillomavirus infection
    362788 (Traf3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    362788 (Traf3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MPS2 Cast Spc29 zf-RING_UBOX Tropomyosin_1 ATG16 KxDL Crescentin GAS FliJ DUF1664 BLOC1_2 T3SSipB Exonuc_VII_L SPATA24
Other DBs
NCBI-GeneID: 362788
NCBI-ProteinID: NP_001102194
RGD: 1304633
Ensembl: ENSRNOG00000008145
UniProt: D3Z9G0
Position
6
AA seq 567 aa
MEPSKKMGAAGAAQPNPPLKLQPDRGAASVLVPEQGGYKEKFAKTVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNEG
RGCVEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRRDLRDHVEKACKYREATCAHCK
SQVPMITLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagccaagcaagaagatgggtgctgctggcgcagcgcagcccaacccacccctcaag
ctgcagcccgatcgcggcgcagcgtcagtgctcgtgccggagcaaggaggctacaaggag
aagttcgcgaagacagtggaggacaagtacaagtgcgagaagtgccgcctggtgctgtgc
aacccgaagcagacggagtgtgggcaccgcttctgtgagagctgcatggccgccctgctg
agctcctcaagtccaaaatgcacagcctgccaagaaagcatcatcaaagacaaggtgttc
aaggataattgctgcaagagagagatcctggcccttcagatctactgtcggaacgaaggc
agaggctgcgtggagcagctgactctgggacatctgctggtgcacctgaaaaacgagtgt
cagtttgaggaactcccctgcctgcgtgccgactgcaaagagaaagtactgaggagagac
ttgcgggatcacgtggaaaaggcctgtaaataccgagaggccacgtgcgcccactgcaag
agccaagtccccatgatcacactgcagaaacatgaagacacggattgtccctgtgtggtg
gtgtcctgccctcataagtgcagcgttcagactcttctgaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccacgaggccagctccgcggtccagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccttgctgcagaatgaaagt
gttgagaaaaacaagagcatacaaagtctgcacaaccagatatgtagctttgagattgaa
attgagagacaaaaggagatgcttcgaaacaatgagtccaaaatccttcatttgcagcga
gtaatagacagccaagcagagaaactgaaagaactcgacaaggagatccgtcccttccgg
cagaactgggaggaagcagacagcatgaagagcagtgtggaatccctccagaaccgtgtg
actgagctagaaagcgtagacaaaagtgcagggcaggcagctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgctgagtgtccacgacatccgcttggccgac
atggacctgcgcttccaggtcctcgagactgccagctacaatggtgtgctaatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctatctctctac
agccagcctttctacacaggttattttggctataagatgtgtgcccgggtctacctgaac
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgcggagaa
tatgatgctctgttgccgtggccattcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgacgccatctgggagatgcgttcaagcctgatcccaacagcagcagcttc
aagaagcccacgggagagatgaacatcgcctctggctgcccagtctttgtcgcccaaact
gttctcgagaacgggacgtacattaaagatgatacaatttttattaaagtcatagtggat
acctcggatctgcctgacccctga

KEGG   Rattus norvegicus (rat): 684173
Entry
684173            CDS       T01003                                 

Gene name
Traf5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    684173 (Traf5)
   04668 TNF signaling pathway
    684173 (Traf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    684173 (Traf5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    684173 (Traf5)
   04657 IL-17 signaling pathway
    684173 (Traf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    684173 (Traf5)
   05203 Viral carcinogenesis
    684173 (Traf5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    684173 (Traf5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    684173 (Traf5)
   05168 Herpes simplex virus 1 infection
    684173 (Traf5)
   05163 Human cytomegalovirus infection
    684173 (Traf5)
   05169 Epstein-Barr virus infection
    684173 (Traf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    684173 (Traf5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    684173 (Traf5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-TRAF_2 zf-C3HC4_4 Sina zf-RING_UBOX zf-RING_2 zf-RING_6 DUF5917 TFA2_Winged_2 DUF4279 SBD_N Fez1 Med4
Other DBs
NCBI-GeneID: 684173
NCBI-ProteinID: XP_038947438
RGD: 1593883
Position
13
AA seq 558 aa
MAHSEEQAVVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARI
ILGRFQDHLQHCSFQAVPCPNQSCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNL
QDHEENSCPAYPVSCPNKCVQTIPRAGVKEHLTVCPEAEQDCPFKHYGCTVKGKRGNLQE
HERAALQDHMLLVLEKNFQLEQQISDLYQSLEQKESKIQQLAGTVKKFEKELKQFTQMFG
RNGSFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQQSRLDLRSLVDAVDSVKQRITQLE
ASDQRLVVLEGETNKHDAHINIHKAQLNKNEERFKLLEGACYSGKLIWKVTDYKAKKREA
MEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIVETFKADPNSSSFRRPDGEMNIASGCPRFVSHSTLESSRNTYIK
DDTLFLKVAVDLTDLEDL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctcattcagaggagcaagcggttgtgccctgtgccttcatccgccagaactctggc
aactccatttccttggactttgagcccgacacagagtaccaatttgtggagcagctggaa
gaacgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacgggctgt
gggcaccgcttctgccagcactgcatcctgtctctgagagaattgaactcggtgccgatc
tgccccgtagacaaggaggtgatcaagcctcaggaggtgtttaaagacaactgctgcaaa
agagaagttctcaacttacacgtctactgcaaaaacgcacctggatgcaatgccaggatt
attctgggacggttccaggaccaccttcagcactgctccttccaagctgtgccctgcccc
aaccagagctgccgggaagccatgctccggaaagatgtgaaagagcatctgagtgcctac
tgccggttccgagaggagaagtgcctttactgcaagagggacatagtggtgactaacctg
caggatcatgaggaaaactcgtgtcctgcatatccagtgtcttgtcccaacaagtgtgtg
cagactattccgagagctggggtgaaggaacacctcactgtgtgccctgaggctgagcaa
gactgtccctttaagcactatggctgcacggtcaagggcaagcgtgggaacttgcaggag
cacgagcgggcagccctgcaggaccacatgcttctggttttagagaagaacttccaacta
gaacagcagatctctgacttatatcagagtctcgagcagaaagaaagcaagatccagcag
cttgcaggaactgtgaagaagttcgagaaagagcttaagcagttcacacagatgttcggc
agaaatggaagtttcctctcaaatgtccaggctctcaccagtcacacggacaagtcggct
tggctggaagcgcaggtgcggcagctgctacaaatagttaaccagcagcaaagccggctt
gatctgaggtctttggtggatgctgtggacagtgtgaaacagaggatcacccagctggag
gccagtgaccagagattagttgttttagagggggagaccaataagcacgacgcacacatt
aatatccacaaagcacagctgaataagaacgaagaacggtttaagctgctggagggcgcc
tgctacagtggcaagctcatttggaaggtgacagattacaaggcgaagaagagggaggct
atggaggggcacacagtgtccgtcttcagccagcctttctataccagccgctgtggctac
cggctctgtgccagagcgtacctgaacggggatgggtcggggaagggaacgcacctgtct
ttgtactttgtggtgatgcggggtgagttcgactcactattacagtggccattcaggcag
agggtgacactaatgcttttggatcagagtggcaagaagaaccacattgtggagaccttc
aaagctgaccccaatagcagcagcttcagaagaccggacggggagatgaacattgcctct
ggctgtccccgctttgtttctcattctactctggagagttccaggaacacctacattaaa
gacgacaccctattcttgaaagtggccgtggatttaactgacttggaggatctgtaa

KEGG   Rattus norvegicus (rat): 687813
Entry
687813            CDS       T01003                                 

Gene name
Traf1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04210  Apoptosis
rno04668  TNF signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    687813 (Traf1)
   04668 TNF signaling pathway
    687813 (Traf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    687813 (Traf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    687813 (Traf1)
   05202 Transcriptional misregulation in cancer
    687813 (Traf1)
   05203 Viral carcinogenesis
    687813 (Traf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    687813 (Traf1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd PilJ
Other DBs
NCBI-GeneID: 687813
NCBI-ProteinID: NP_001258169
RGD: 1596290
Ensembl: ENSRNOG00000048914
Vega: OTTRNOG00000002313
UniProt: M0R5V5
Position
3
AA seq 409 aa
MASSSAPDENEFQFGCPPAPSQDPSEPRALCCTACLSENLRDDEERICPKCRADGLQPVS
PGSLLTQEKVLPDVAEAGIVCPFAGVGCSFKGSPQSVQEHEATSQSSHLYLLLGVLKEWK
SSPGPNLGSAPMALEQNLSELQLQEAVEVTGDLEVDCYRAPCCESQEELALQHLLKEKLL
AQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHVLNLEQRVVELQQTLAQKD
QVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCL
RLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLS
SASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcctccagctcagcccctgatgaaaacgagtttcaatttggttgtccccctgctccc
agccaggacccatcggagcccagagctctctgctgcacagcctgtctctctgagaacctg
agagacgatgaggaacggatctgtcctaaatgcagagcagacggcctccaacctgtgagc
ccaggaagccttctgactcaggagaaggttctccctgatgtggctgaggctggaatcgtg
tgtccctttgcaggtgttggctgttccttcaaggggagcccacagtccgtgcaggagcat
gaggccacctcgcagtcctcacacctgtacctgcttctgggggtcctaaaggagtggaaa
tcctcaccaggtcccaacctgggctctgcacccatggcactggagcagaacctgtcggag
ctgcagcttcaggaagctgtggaagtgacaggggacctggaggtagactgctaccgggca
ccttgctgtgagagccaggaagaactggctttgcagcacctcctgaaggagaagctgctg
gctcagctggaggagaagctgcgtgtgttcgcgaacatagttgctgtcctcaacaaggaa
gtggaggcttcccacctggcgctggccgcctccatccaccagagtcagttggaccgagag
cacgtcctgaacttggagcagagggtggtggagttacagcagaccctggctcaaaaagac
caggttctgggcaaacttgagcacagtctgcgactcatggaggaggcgtcctttgatggt
actttcctgtggaagatcaccaatgtcaccaagcggtgccacgaatcagtgtgtggcagg
actgtcagcctcttctctccagctttctacactgccaagtacggttacaagttgtgcctg
cgcctgtacctgaatggggatggctcaggcaagaagacccacctgtccctgttcattgtc
atcatgaggggagaatatgacgctctgctgccctggcctttccggaacaaggtcaccttt
atgctacttgaccagaacaaccgtgagcacgccattgatgccttccggcctgacctgagc
tcagcctccttccagcggccgcagagtgagaccaacgtggccagcggctgcccgctcttc
ttccccctcagcaagctgcagtcgcccaagcacgcctacgtaaaagatgatacaatgttc
ctcaaatgcattgtggacaccagtgcttag

DBGET integrated database retrieval system