KEGG   Rattus norvegicus (rat): 304833
Entry
304833            CDS       T01003                                 

Symbol
Ro60
Name
(RefSeq) 60 kDa SS-A/Ro ribonucleoprotein
  KO
K11089  60 kDa SS-A/Ro ribonucleoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    304833 (Ro60)
SSDB
Motif
Pfam: TROVE DUF2201 VWA_2 Cut12
Other DBs
NCBI-GeneID: 304833
NCBI-ProteinID: NP_001100653
RGD: 1305083
Ensembl: ENSRNOG00000003434
UniProt: D3ZRN5
Position
13
AA seq 538 aa
MEESANQLQPLSDNQVANSEGGYVWQVTDMNRLHRFLCFGSEGGTCYIKEQKLGLENAEA
LIRLIEDGRGSEVIQEIKSFSQEGRTAKQEPLLFALAICSQCADVSTKQAAFKAVPEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAVADWYNEKGGMAVALAVTKYKQRNGWSHK
DLLRLSHLKPNSEGLAIVTKYITKGWKEVHEQYKEKPLSVETDKLLKYLEAVEKVKRTKD
DLEVTHLIEEHQLVREQLLTSHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGSSE
VSLVCEKLSNEKLLKKARIHPFHVLTALETYRTGHGLRGKLKWIPDKEILQALDAAFYKT
FKTVEPTGKRFLLAVDVSGSMDQRVLGSVLNASTVAAAMCMVVTRTEKESSVVAFACDMV
PFPVTTDMTLQQVLTAMNKVPAGTTDCSLPMIWAQKTGTAADVFIVFTDNETFAGQVHPA
IALREYRKKMAIPAKLLVCGMTSNGFTIADPDDRGMLDMCGFDTAALDVIRNFTLDVI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggaagagtctgcaaaccagttgcagcctctgagtgacaatcaggtagccaactccgag
ggcggatatgtctggcaggtcaccgacatgaaccggctgcaccgcttcttgtgtttcggt
tccgaaggcggcacctgctatatcaaagaacagaagctgggccttgagaatgccgaagcc
ttaattagactgatcgaagatggcagaggaagcgaagtgatccaggaaatcaagtccttt
agtcaggaaggcaggactgccaaacaggagccattgctctttgcactggccatctgttcc
cagtgtgcagacgtcagcacaaagcaagcagcatttaaagctgtccccgaagtgtgtcgc
atcccgacccacctcttcactttcatacagtttaagaaagacctgaaggagagcatgaag
tgtggaatgtggggtcgcgctctccggaaggccgtggcagactggtataatgaaaaaggc
ggcatggccgtcgccttggccgttacaaagtataaacagagaaatggctggtctcacaaa
gatctcctacgactgtcccaccttaaacctaacagtgaaggacttgctattgtgaccaaa
tatatcacaaagggctggaaagaagttcatgaacagtataaagaaaaaccactttctgtg
gagacggacaaactactaaagtacctggaggctgtggagaaagtgaagcgcacaaaggac
gacctggaagtcactcatctgattgaagagcaccagttagtcagggagcagctgctgacc
agccacctgaagtctaaagaggtatggaaggctttgttacaagaaatgccccttactgca
ctcctaaggaacctgggaaagatgactgccaattcagtgcttgaaccaggaagttctgaa
gtttctttagtatgtgaaaaactgagcaatgaaaaactgcttaagaaggctcgtatacat
ccatttcacgttttaactgcattagagacctacagaacaggccatgggctccgaggaaag
ttgaagtggattccagataaagaaatcttgcaagcattggatgctgctttttataaaaca
tttaagacagttgagccaactgggaagcgcttcttgctggctgttgatgtcagtggttct
atggaccagagagtcttgggtagtgtactcaatgctagtactgttgccgcggcaatgtgc
atggtggttacacggacagagaaagagtcttcagtagttgcttttgcgtgtgatatggta
ccatttccagtgacgacagacatgacattacagcaggttttaacggctatgaacaaagtt
ccagcaggcaccacggattgctctcttccaatgatctgggcccagaaaacaggcacagct
gcagacgtcttcatcgtgttcactgataatgagacctttgctgggcaggtgcacccggct
attgccctgcgggagtaccgaaagaaaatggctattcctgctaaattgcttgtttgtggg
atgacatcaaacggctttacgatcgcagacccagacgatagaggcatgttggatatgtgc
ggctttgatactgcagctctggatgtaattcggaatttcacgttggatgtcatttaa

KEGG   Rattus norvegicus (rat): 308901
Entry
308901            CDS       T01003                                 

Symbol
Trim21
Name
(RefSeq) E3 ubiquitin-protein ligase TRIM21
  KO
K10651  tripartite motif-containing protein 21 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    308901 (Trim21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    308901 (Trim21)
   04131 Membrane trafficking [BR:rno04131]
    308901 (Trim21)
   04121 Ubiquitin system [BR:rno04121]
    308901 (Trim21)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     308901 (Trim21)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     308901 (Trim21)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    308901 (Trim21)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    308901 (Trim21)
SSDB
Motif
Pfam: SPRY PRY zf-B_box zf-RING_UBOX zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-C3HC4_2 zf-RING_6 zf-RING_5 Prok-RING_4 U-box zf-RING_4 zf-RING_10 DUF6439
Other DBs
NCBI-GeneID: 308901
NCBI-ProteinID: NP_001076041
RGD: 1305795
Ensembl: ENSRNOG00000018517
Vega: OTTRNOG00000002269
UniProt: D4ACF2
Position
1
AA seq 471 aa
MSHSTTSKMSLEKMWEEVTCSICLEPMVEPMSIECGHCFCKECISEVGGNGGGSCPVCRQ
HFLLRNLRPNRHIANMVENLKQEAQNTKKGTQEVHCMKHGEILHLFCEEDGQALCWVCAQ
SGKHRDHTKVPIEEAAKIYQEKIHKALEKLRKGKELAEKLEMDLAMQRTDWKRNIDTQKS
RIHEEFAHQNSLLAQEEQRQLQRLEKDEREHLRLLGEKEAELAEKNQALQELISELERRS
RGSELELLKEVRIVLERSVSWKLDTVDVDSPDLTSTCHVPGRKKMLRTCWVHITLDRDTA
NSCLIISKDRRQVRMGDTYQNVSENAERFNNYPMVLGAQRFSSGKMYWEVDVTQKQAWDL
GVCRDSVQRKGHFSLSPENGFWTIWLWQKDNYEAGTSPQTTLHIQVPPCQIGIFVDYEAG
IVSFYNITDHGSLIYTFSECAFIGPLRPFFSVGFNDDGGNSAPLKLCPLKI
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcacactctacaacctcaaaaatgtccctggaaaagatgtgggaggaggtcacctgt
tctatctgcctggagcccatggtggagcctatgagtatcgaatgtggccactgcttttgc
aaggaatgcatttctgaggttgggggaaatgggggcggttcatgtcccgtgtgccggcaa
cactttctgctcagaaacctcaggcccaatcggcatatagcaaacatggtggaaaacctt
aaacaagaggcccagaataccaaaaagggcacccaggaagtgcactgcatgaagcatgga
gagatacttcacctgttctgtgaggaagatgggcaggccctttgctgggtgtgtgcccag
tctgggaaacaccgggaccacaccaaggtccccattgaagaggctgctaagatataccag
gagaagattcacaaggctttagaaaaactgagaaaagggaaagagttggccgagaagttg
gaaatggatcttgcaatgcaaagaacagactggaagaggaacattgacacccagaagtcg
aggattcacgaagagttcgcacatcagaatagcttgctggctcaggaggaacagaggcag
ctgcagaggctggagaaggatgaaagggagcacctgagactccttggggagaaggaggct
gagctggctgagaagaaccaggccctgcaggaactgatctcagagctggagaggaggagc
cgaggttcagaactggagctattgaaggaggtgaggatcgtcctggaaaggagtgtatcc
tggaaactggacacggtagatgttgattccccagacctgacaagcacatgccatgtgcca
gggcggaagaagatgctgaggacctgttgggttcatattactctggatcgtgacactgcc
aactcgtgcctcatcatctcaaaggatcggagacaagtgaggatgggagacacctatcag
aatgtgtctgaaaatgctgagagatttaataattaccccatggtgctaggtgcccagaga
ttctcctctgggaagatgtactgggaggtagatgtgacccaaaagcaggcctgggatttg
ggggtttgcagagattctgtacagaggaaagggcatttttcactcagtcctgaaaatggc
ttctggaccatttggctttggcaaaaagacaactatgaggctggtaccagtcctcagacc
accctccatattcaggtacctccgtgccaaattgggatctttgtagactatgaagctggc
attgtctccttctacaacataactgaccacggctccctcatctacaccttctcagagtgt
gcttttatcggacctctgcgacccttctttagtgtcggtttcaatgatgatggggggaat
tcagcccctctaaagctctgtccactaaagatatga

DBGET integrated database retrieval system