KEGG   Rattus norvegicus (rat): 304971
Entry
304971            CDS       T01003                                 

Gene name
Tomm40l
Definition
(RefSeq) mitochondrial import receptor subunit TOM40B
  KO
K11518  mitochondrial import receptor subunit TOM40
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    304971 (Tomm40l)
   05022 Pathways of neurodegeneration - multiple diseases
    304971 (Tomm40l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    304971 (Tomm40l)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    304971 (Tomm40l)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    304971 (Tomm40l)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   304971 (Tomm40l)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 304971
NCBI-ProteinID: NP_001076807
RGD: 1562006
Ensembl: ENSRNOG00000003398
UniProt: A4F267
Position
13
AA seq 308 aa
MGNTLGLAPMGTLPRWSHRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHF
QVAHTVHMSALGLPGYHLHTAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLR
AKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSITHRLVLGG
ELVYHRRPGEEGAILTLAGKYSALHWVATLNVGSGGAHASYYHKANEQVQVGVEFEANTR
LQDTTFSFGYHLTLPQADMVFRGLVDSNWCVGAVLEKKMRPLPVTLALGAFLNHWRNRFH
CGFSITVG
NT seq 927 nt   +upstreamnt  +downstreamnt
atggggaacaccctgggcctggcaccgatggggactttaccccgctggagccaccgtcgg
gaggaaccgctgcccaaccccgggagcttcgatgagctgcaccggttgtgcaaagatgta
ttcccagcacagatggaaggcgtgaagctggttgtcaacaaggttctgagcagccatttc
caggtggctcatactgtgcacatgagtgccctgggcttgccagggtaccacctccatacc
gcctatgcaggggactggcagcttagtcccacagaggtgttccccactgtggtgggggat
atggacagcagtggcagtctcaacgcccaggtcttgcttctgttggcagaacggctgcga
gctaaggctgtcttccagacacagcaagccaagttcctgacatggcagtttgatggtgaa
tatcgaggagatgactacacagccactctgaccctgggaaatccggatctgattggggaa
tcagtgattatggttgctcacttcctgcaaagcatcactcatcggcttgtactaggaggg
gagctagtttatcaccggcggccaggagaagagggagccattttgactctggctgggaag
tactcagctcttcactgggtagctacattgaatgttgggtcaggtggggcccatgcaagt
tattaccacaaggcaaatgaacaggttcaggttggagtagagtttgaagcaaatacaagg
ctacaagatacaaccttctcctttggttaccacctgactctgccccaggccgatatggtg
tttagaggcttggtggatagtaactggtgtgtaggtgctgtgttggagaagaagatgcgt
cccctgcctgtcaccctagccctcggagccttcctcaatcactggcgaaacagattccat
tgtggcttcagcatcactgtgggctga

KEGG   Rattus norvegicus (rat): 308416
Entry
308416            CDS       T01003                                 

Gene name
Tomm40
Definition
(RefSeq) mitochondrial import receptor subunit TOM40 homolog
  KO
K11518  mitochondrial import receptor subunit TOM40
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    308416 (Tomm40)
   05022 Pathways of neurodegeneration - multiple diseases
    308416 (Tomm40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    308416 (Tomm40)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    308416 (Tomm40)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    308416 (Tomm40)
Transporters [BR:rno02000]
 Other transporters
  Primary active transporters [TC:3]
   308416 (Tomm40)
SSDB
Motif
Pfam: Porin_3
Other DBs
NCBI-GeneID: 308416
NCBI-ProteinID: NP_997685
RGD: 1303022
Ensembl: ENSRNOG00000018556
UniProt: Q75Q40
Position
1
AA seq 361 aa
MGNVLAASSPPAGPPPPPTPSLVGLPPPPPSPPGFTLPPLGGGLGTGSNAGRGSERTPGA
AASGAAASSNDGNCGCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNRFQVTHTVA
LGTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLSPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRR
PGEKGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSAS
FGYQLDLPKANFLFKGSVNSNWIVGATLEKKLPPLPLTLSLCAFLNHRKNKFLCGFGLTI
G
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggggaacgtgttggctgctagctctccgcccgcagggccaccgccgcctcctacgccg
tccctcgtggggctcccgccgccgcctccttcgccgccaggcttcacgctgccgccactt
ggaggtggcctgggcactgggtcaaacgctggtcgcggttcggaacggactcccggggcc
gcggcgagcggcgctgcggcgtcctcgaacgatgggaactgcggctgcctgcccaacccg
gggacgttcgaggagtgccaccggaagtgcaaggagctgtttccagttcagatggaaggt
gtcaaacttacagtcaacaaagggttaagcaatcgtttccaggtgacccatacagtagcc
ctcggcacaattggggagtccaactaccacttcggggttacatacgtggggacaaaacag
ctgagtcccacagaggcgttccccgtgctggtgggtgacatggacaatagtggcagcctc
aatgcacaggtcatccaccagctgagcccaggcctcaggtccaagatggccatccagacc
cagcagtccaagttcgtgaactggcaggtggatggcgagtaccgtggctccgacttcacg
gctgctgtcaccctgggcaacccagatgtcttggtgggttcaggaatcctcgtggctcac
tacctccagagcatcacaccgtgtctggccctaggtggcgagctcgtctaccaccggcgg
cctggagaaaagggcactgtcatgtctctagctgggaaatacacactgaacaactggttg
gctacagtaacgctgggtcaggcaggcatgcatgctacgtattaccacaaagccagtgac
cagctgcaggtgggtgtggagtttgaggccagcaccaggatgcaggacaccagtgcctcc
tttgggtatcagctggacctgcccaaggccaacttcctcttcaaaggctctgtgaacagt
aactggatcgtgggtgccacgctggagaagaagcttccgcccttgcccctgacactgtcg
ctctgcgccttcctgaaccaccgcaagaataagttcctgtgtggctttggcctcaccatc
ggctga

DBGET integrated database retrieval system