KEGG   Rattus norvegicus (rat): 305999
Entry
305999            CDS       T01003                                 

Gene name
Nkx3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    305999 (Nkx3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    305999 (Nkx3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    305999 (Nkx3-1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    305999 (Nkx3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 305999
NCBI-ProteinID: NP_001029316
RGD: 1305369
Ensembl: ENSRNOG00000015477
UniProt: Q497B7
Position
15
AA seq 238 aa
MLRVAEPQEARLEAGGRSPWAAPPTQSKRLTSFLIQDILRDHAERRGGQPSTPQHQCQPD
PKRDSASELDEAEGSSVTLEDPPGIRSSPTETRAETESDAHFETYLLDCEHTPVLSSAPQ
VTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYK
TKRRQLSEDLGVLEKNSTLSLPTLKDDSLSRASLVSVYASYPYYPYLYCLGSWHPTFW
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcttagggtagcggagccccaagaggcacggttggaggcgggtggtcgcagtccctgg
gcagcgccacccacgcagtccaagcggctcacgtccttcctcatccaggacatcctgcgg
gaccacgcagagcggcgtgggggacagccgagcaccccgcagcaccagtgccaaccagac
cctaagagggattctgcttcagagctcgacgaagcagagggtagcagtgtgactctggag
gacccgccaggtatccggtcgagccccacagagacacgggctgaaaccgagtcagatgca
cattttgagacttatctgttggactgtgaacatactccagtcttatcaagtgccccccag
gtcaccaagcagccacagaagcgttcccgggctgctttctctcacactcaggtgattgag
ttggagaggaagttcagccatcagaagtacctgtccgcccctgaaagggctcacctggcc
aagaacctcaaactcaccgaaacccaagtaaaaatatggttccagaacagacgctacaag
actaagcgaaggcagctgtcagaagacctgggagtcttggagaagaactccacattgtct
ttgccaaccctgaaagatgacagcctatccagggcctccttggtctccgtgtatgctagc
tacccctactacccctacctatactgtctgggcagctggcatccaactttctggtaa

DBGET integrated database retrieval system