KEGG   Rattus norvegicus (rat): 306722
Entry
306722            CDS       T01003                                 

Gene name
Dapk1
Definition
(RefSeq) death-associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05200  Pathways in cancer
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    306722 (Dapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    306722 (Dapk1)
  09162 Cancer: specific types
   05219 Bladder cancer
    306722 (Dapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    306722 (Dapk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     306722 (Dapk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   306722 (Dapk1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death COR Kdo RIO1 O_Spanin_T7 TCAD9 AAA_29 APH ABC_tran AAA_23 Choline_kinase RsgA_GTPase
Other DBs
NCBI-GeneID: 306722
NCBI-ProteinID: NP_001100805
RGD: 1311629
Ensembl: ENSRNOG00000018198
UniProt: F1LNN8
Position
17
AA seq 1430 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIRHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEF
FRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVARALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLLGHGCLVDFQDRHGNTPLHVACKDGSAPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTLDGKTAEDLAKAEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLATKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVSVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDMVAKHNVNTRASRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
NT seq 4293 nt   +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggacgactactacgacaccggcgaggaactgggc
agcggacagttcgccgttgtgaagaaatgtcgtgagaaaagtaccggtcttcagtatgcg
gccaagttcatcaagaaaaggaggaccaagtccagccggcggggcgtgagccgagaggac
atcgagcgggaggtcagcatcctgaaggagatccggcacccaaacgtcatcaccctgcat
gaggtctacgagaacaagacagacgtcattctgatcctggagcttgttgcaggaggcgag
ctgtttgacttcctggctgagaaggaatctctcactgaagaagaagcaaccgagttcctc
aagcagatcctcagcggcgtttactacctgcactcgcttcaaatcgcccactttgacctg
aagccggaaaacataatgcttctggatagaaatgtgcccaaacctcggatcaagatcatc
gacttcggcctggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgtggctccggagatcgtcaactatgagccccttggtcttgaggcagacatg
tggagcattggggtaataacctatatcctcctaagcggggcctccccttttcttggagac
accaagcaagaaacattagcgaatgtatctgctgtcaactatgactttgaggaggaattc
ttccgcaacaccagtacccttgccaaagatttcatcagaaggctgctggtcaaggatcca
aagaagaggatgacaatccaggacagtttgcagcacccctggatcaagcctaaagacacc
caacaagcacttagtcgaaaagcctcagcagtaaacatggagaaattcaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcatttttgtccagaagtaacatgagcgttgccaggagcgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcattcatgccatcaatgatgacaacgtccccggcctg
cagcacctcctgggctcattgtccagctatgatgtcaaccagcccaacaagcacgggaca
cctccattactgattgctgcaggctgtgggaatattcagatgttacagttactcataaaa
cggggctcaaggatcgacgtccaggataagggaggatccaatgctatctactgggcctct
cggcatggccatgtggatactttgaagtttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacagctcttcacgtggcagcccgctatggccatgcagatgtg
gttcaactcttgtgcagttttggctctaatcctgatttccaggacaaggaagaggaaacc
cccctgcactgtgctgcctggcacggctattactccgtggctagagctctttgtgaagtt
ggctgtaacgtgaatatcaagaaccgggagggagagaccccactgctgacagcttctgcc
aggggctaccatgacattgtggagtgtctggctgaacatggagctgacctgaatgcttct
gacaaggatgggcacatcgcccttcatcttgctgtgaggcgctgtcagatggaggtcatc
aagaccctccttggccatgggtgccttgtggatttccaggatcggcatggcaacaccccc
ctgcatgtggcctgcaaagatgggagcgcgcccatcgtggtggccctctgtgaagccagc
tgcaacctggacatctcaaacaagtatggtcggactcctctccaccttgcagccaacaac
gggatcctagatgtggtccgctacctctgcctgatgggcgccaacgtggaggctctgacc
ttggatggcaagacggccgaggacctcgccaaggcagagcagcacgagcacgtggcaggg
ctcctggcaagactgcggaaggacacacaccgagggctcttcatccagcagctccgaccc
acgcagaatctccagcccagaatcaagctcaaactgtttggccactcgggatcggggaaa
tccacactggtggaatctctcaagtgtgggctgttaaggagtttcttcagaaggcgccgg
cccagactgtcctctaccaactccacccgcttcccaccgtcgcccctggctactaagcca
acagtctcagtgagcattaacaacctgtaccccggctgtgagaatgtgagcgtgaggagc
cgaagcatgatgtttgagccaggcctcaccaaagggatgctggaagtgttcgtggctccg
tctcaccacctacactgctcgaccgatgaccagtccaccaaagccatcgacatccagaat
gcttacttgaacggagttggtgatttcagcgtatgggagttctctggaaaccctgtgtac
ttctgttgctatgactacttcgccgccaacgatcccacatccatccacatcatcgttttc
agtctcgaagaaccctatgagatccagctgaaccaagtgattttctggcttagtttcttg
aagtctctggtctcagttgaagaacccatagcatttggaggcaagctgaagaaccctctc
cgagttgtcctggtggccacacatgctgacatcatgaacatccctcggcctgctgggggc
gagtttggatatgataaagatacatccttgctgaaagagatcaggaacaggtttgggaat
gaccttcatgtctcaaataagctgtttgtgctggatgcaggagcatctgggtctaaggac
atcaaggttctccggaatcacctgcaagaaatacggagtcagattgtctcggggtgccct
cccatgactcatctgtgtgagaagatcatctccactctgccctcctggcggaagctcaac
gggccaaaccagctgatgtcgctccagcagtttgtgtatgacgtgcaggaccagctgaac
cccctggcctccgaggatgacctcaggcgcattgcacagcagctgcacagcacgggagag
atcaacatcatgcagagtgagacagtgcaggatgtgttgctgctggatcctcgatggctc
tgcaccaacgtcctggggaagctgctgtctgtggagactccccgagccctgcaccattat
cggggccgctacaccatggaagatatccagcgtctggtccccgacagtgacgtggaggag
ctgctgcagatcctggatgccatggatatctgcgcccgagacctgagtagcgggactatg
gtggatatccctgctctaatcaaaacagacagcctgcagcgctcctgggccgatgaggaa
gacgaggtgatggtgtacggaggtgtgcgcatcgtccctgtagagcacctcactcccttc
ccctgtggcatctttcacaaagttcaggtcaacctgtgccggtggatccaccagcagagc
actgagggggacgcggacatccgtctgtgggtgagcggctgcaggatcgccaaccgtggg
gctgagttgctggtgctgctggtcaatcacggtcagggcattgaggtacaggtgcgtgga
ctggagaccgagaagattaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
actgtcatggccaccaccttgccagggctgttgacggtgaagcactacctgagcccccag
cagctaagggagcatcacgaaccagtcatggtctaccagccccgggacttcttccgtgcg
cagaccctgaaagagagctccctcaccaacaccatgggagggtacaaggagagcttcagc
agcatcacgtgctttgggtgtcacgatgtctactcacaggccagtcttggcatggacatc
catgcatcagacctgagtctcctgacccggaggaaactgagtcgtcttcttgacccaccg
gaccccatggggaaggactggtgccttctggccatgaacttgggcctcccggacatggtg
gccaaacacaacgtcaataccagggcttctagggatttcctccccagcccagtgcatgcc
ttgctacaggaatggacctcctaccctgagagcacggtgggcatccttatatccaaactt
cgggagctggggcgccgggatgctgcggactttttactgaaggcctcctctgtgttcaag
atcaaccttgacggcaatggccaggaggcctatgcctcaagctgtaacagtggcacatcc
tacaattccataagctcagtggtgtcccggtga

KEGG   Rattus norvegicus (rat): 64391
Entry
64391             CDS       T01003                                 

Gene name
Dapk3
Definition
(RefSeq) death-associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05200  Pathways in cancer
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64391 (Dapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64391 (Dapk3)
  09162 Cancer: specific types
   05219 Bladder cancer
    64391 (Dapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64391 (Dapk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64391 (Dapk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   64391 (Dapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 ABC1 TCAD9 Choline_kinase
Other DBs
NCBI-GeneID: 64391
NCBI-ProteinID: NP_071991
RGD: 621766
Ensembl: ENSRNOG00000020383
UniProt: O88764
Position
7
AA seq 448 aa
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREE
IEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREY
SLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRVAAEQREA
RCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAA
QVAAEVQFVRDLVRALEQERLQAECGVR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtccacgttcaggcaggaggacgttgaggaccattatgagatgggagaggagcttggc
agcggccagttcgccatcgtgcgcaagtgccagcagaagggcaccggcatggagtacgcg
gccaagttcataaagaagcggcgcctgccgtccagccggcgcggtgtgagccgtgaggag
atcgagcgcgaggtgagcatcctgcgcgagatccgccaccccaacatcatcacgctgcac
gatgtgttcgagaacaagacagatgtggtgctgatcttggagctggtgtccggcggcgaa
cttttcgactttctggctgagaaggagtcactgacagaggatgaggccacgcagttcctc
aagcagatcctggacggtgtccactacctgcactccaagcgcatcgcgcactttgacctg
aagccggagaacatcatgttgctggacaagcatgcagccagcccacgcattaagctcatc
gactttggcatcgcgcacaggatcgaggccggtagcgagttcaagaacatctttggcacg
ccagagttcgtcgcccctgagattgtaaactatgaaccacttggcttggaagctgatatg
tggagcatcggcgtcatcacctacatcctcctgagcggggcgtccccattcctgggggag
accaagcaggaaacgctgacaaacatctcggctgtgaactatgactttgatgaagagtac
ttcagcagcaccagtgaactggccaaggacttcatccgaaggctgctggtcaaagatccc
aagaggaggatgaccatcgcacagagcctggagcattcctggatcaaggttcgccggcgt
gaggacggcgcccggaagccagagcgacgccgactgcgcgcggcgcgcctgcgcgagtac
agtctcaagtcgcactcaagcatgccgcgaaacacgagctacgccagcttcgagcgcttc
tcgcgcgtgctggaggacgtggcggcggcggagcaggggctgcgcgagctgcagcggggc
cggcggcagtgccgggagcgcgtgtgcgcgctgcgcgtggctgcggaacagcgggaggcg
cgctgccgcgacgggagcgccgggctaggccgcgacctgcgacgcctgcgcacggagctg
ggtcgcaccgaggctctgcgcacgcgcgcgcaggaggaggcacgggcagcgctcttgggc
gctggtggcctgaaacgtcgcctgtgtcgccttgagaaccgctacgacgcgctagccgca
caggtggctgctgaggtgcagttcgtgcgcgatctggtacgcgcgctggagcaggagcgg
ctgcaggccgagtgcggcgtgcgctag

DBGET integrated database retrieval system