KEGG   Rattus norvegicus (rat): 308937
Entry
308937            CDS       T01003                                 

Symbol
Wee1
Name
(RefSeq) wee1-like protein kinase
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    308937 (Wee1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    308937 (Wee1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    308937 (Wee1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    308937 (Wee1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     308937 (Wee1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  WEE family
   308937 (Wee1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    308937 (Wee1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo
Other DBs
NCBI-GeneID: 308937
NCBI-ProteinID: NP_001012760
RGD: 1307895
Ensembl: ENSRNOG00000010017
UniProt: Q63802
Position
1
AA seq 646 aa
MSFLSRQQPPPTRRAAAACSLRQKLIFSPGSDCEEEEEEEEEGSGHSTGEDSAFQEPDSP
LPSARSPAEAEAERRRRSPGAEPSSPGELEEDLLLRGGGGGAQAAGGGAEGDSWEEEGFG
SSSPVKSPTTAYFLGSSFSPVRCGGPGDASPRGCGVPRAMDDPCSPQPDYPSTPPHKTFR
KLRLFDTPHTPKSLLSKARVIDSSSVKLRGSSLFMDTEKSGKREFDTRQTPQVNINPFTP
DPVMLHSSGQCRGRKRAYFNDSSEDMEASDYEFEDETRPAKRITITESNMKSRYTTEFHE
LEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHPHVVR
YFSAWAEDDHMLIQNEYCNGGSLADAVSENYRVMSYFTEAELKDLLLQVGRGLRYIHSMS
LVHMDIKPSNIFISRTSIPNAVSEEGDEDDWISNKVMFKIGDLGHVTRISSPQVEEGDSR
FLANEVLQENYSHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQE
LTELLKVMIHPDPERRPSAMVLVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKA
QMAAKVAAEERALLTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagcttcctgagccgacagcagccgccgcccacccgccgcgccgcagccgcctgcagt
ttgcggcagaagctcatcttctcacccggcagcgattgtgaggaggaagaggaggaggag
gaggaaggcagcggccacagtacgggggaggactcggccttccaggagcctgattcgccg
ctgccctctgcacgcagccctgccgaggccgaggccgagcgccgccgccgctcgcccggc
gcggagcccagcagcccgggagagctggaggaggacttgctgctgcggggcggcggcggg
ggcgcgcaagcggcgggcggaggagccgagggcgactcttgggaggaggagggtttcggc
tcttcgtcgcccgtcaagtcacctacgactgcctactttctgggcagctcgttctcgccg
gtgcgctgcggcggccctggggatgcctccccgcggggctgcggggtcccgcgagccatg
gacgacccctgttctccgcagcccgactacccgagcacccctccgcacaagaccttccgc
aagttgcgcctgttcgacacgccgcacactcccaagagtttgctttccaaagctcgagtt
attgattccagctctgttaaactccggggtagttctctattcatggacactgaaaaatca
ggaaaaagagaattcgacacacggcaaactcctcaagtgaatattaacccctttactccg
gatcctgtaatgcttcattcctcaggacagtgtcgtgggagaaagagagcatattttaat
gattcctctgaagacatggaagccagtgattatgagtttgaagatgaaacaagacctgcc
aaaagaattacaattactgaaagcaatatgaagtcacgatatacaactgaatttcatgag
ctggagaaaattggttctggagaatttggttctgtgtttaaatgtgtgaagaggctagat
ggatgcatttatgccattaaacgatcaaaaaagccattggctggctctgttgatgaacag
aatgctttgagagaagtgtatgctcatgctgtgcttggacagcatccccatgtggttcgt
tatttctctgcctgggcagaagatgaccatatgcttatacagaatgaatactgtaatggt
gggagtttagctgacgctgtaagtgagaactacagagtcatgagctactttactgaagca
gagctgaaggatctccttttgcaagttggcaggggcttgagatacatacattcaatgtct
ttggttcacatggatataaaacctagtaatatttttatatctcgaacctcaatcccaaat
gcagtctctgaagaaggagatgaagatgactggatatccaacaaagttatgtttaaaata
ggtgatcttgggcatgtaacaagaatctctagtccacaagttgaagaaggtgatagtcgt
tttctagcaaatgaagttttacaagagaactatagccatctaccgaaagcagatattttt
gctcttgctctcacagtcgtatgtgctgctggtgctgaaccccttcccagaaatggagac
cagtggcatgaaatccgacagggtcgattacctcggattccacaagtgctttcccaggag
ttgacagagttgctaaaagttatgattcatcctgatccagagagaagaccttcagcaatg
gtgctggtgaagcattcagtgttgctgtctgcctctagaaagagcgcagagcagttacga
atagaattgaatgctgaaaaattcaaaaattctcttttgcagaaagaactcaagaaagcc
caaatggcagccaaagttgcagctgaggaacgggcactcctcacagatcggatggccact
agatctaccacccagagtaatagaacttctcgacttattggaaagaaaatgaaccgctct
gtcagccttactatatactga

KEGG   Rattus norvegicus (rat): 502750
Entry
502750            CDS       T01003                                 

Symbol
Wee2
Name
(RefSeq) wee1-like protein kinase 2
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    502750 (Wee2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    502750 (Wee2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    502750 (Wee2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    502750 (Wee2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     502750 (Wee2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  WEE family
   502750 (Wee2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    502750 (Wee2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF4515 HAP1_N RPW8
Other DBs
NCBI-GeneID: 502750
NCBI-ProteinID: XP_038964568
RGD: 1587197
Ensembl: ENSRNOG00000026446
Position
4
AA seq 557 aa
MADAETDQELNKKLNFSFCEEDTENEGQMTAQDIGRAQSQKPRRDQSEELEGPVSSPRDE
LYTSLNRDKQSPGPALRTSVSDFSTCPDTPVLNSKSKLPVPTNFSTPKNLLGQPEISSLE
KLYVRSSKHLRLTPTSLMDEKTSLSLVNINPFTPETYRKLFLQSKGKRKTRDYLEETGEG
ESKAMWLPAKRSVLQETNMASRYEKEFFEVEKIGVGEFGTVYKCIKRLDGCIYAIKRSAK
SFSGLSNDLDLHEVYAHAVLGHHPHVVRYYSSWVEDNHVVIQNEYCNGGSLQAAISENAD
SDNHFQEPKLKDILLQISLGLKYIHNSGMVHLDIKPSNIFICHKIQSDCPVGPEETESEA
DWFLNANVMYKIGDLGHATSISKPKVEEGDTRFLANEILQENYQHLPKADIFALGLTIAM
AAGAEPLPINGDKWHHIRKGNFPEISQELSDDFYGLLKNMIHPVPEERPSAATLARSRIL
WPFLEKTEELQKQLNLEKSKTATLKRELKKAQHIHTPQRDVHHCYQQTYKSSRSTRHLLV
GGRRKEPPSFTCGAASV
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggctgacgcagagactgaccaggagctgaacaagaaattaaacttctccttttgtgaa
gaagatactgagaatgaaggacagatgaccgcacaagacattggaagggcccagagtcaa
aagcccaggagggatcaaagtgaggagttggagggtcccgtgtcttcccccagagatgaa
ctttatacgtctctgaacagagacaagcaaagtccaggtcctgctcttcggacatcagtt
tcagacttttccacatgtcccgacactccagtattaaacagcaagagcaagctgccggtc
cctaccaacttctccactcccaaaaatttgctgggtcagccagagatttcttcgctagag
aagctctatgtccgaagctctaaacatctgagactcacacctacttccctcatggatgag
aagacctctttgtctctggtcaatatcaacccattcactccggagacctatagaaaacta
ttccttcaatcaaagggcaagaggaaaaccagggactatcttgaggaaactggagaaggg
gaaagcaaagccatgtggctgcccgctaagagaagtgttctacaagaaactaatatggct
tcccgctatgaaaaagaattcttcgaggtagaaaaaattggggttggggaatttggtaca
gtctacaagtgcatcaagaggctggatggatgcatttatgcaataaagcgctctgcaaaa
tccttttcaggattatcaaatgatttggatttgcatgaagtttatgctcatgcagtgctt
ggccatcatccccatgtagtgcgctactactcatcctgggtagaagacaatcacgtggtc
attcaaaatgaatactgtaatggtgggagcctgcaagctgctatatctgaaaatgctgat
tcagataatcacttccaagagcccaaactcaaagacattcttctgcagatttccctggga
cttaagtacatccacaactctggcatggtgcacttggacatcaaacccagtaacatcttc
atttgtcataagatacagagtgactgtcctgtagggccagaagagactgaaagcgaagct
gactggtttctcaatgccaatgtgatgtataaaattggtgacctgggccacgcgacatcc
atcagcaaacctaaagtggaagaaggagatactcgtttcctggctaatgagatcctgcaa
gagaattatcaacaccttcccaaagcagacatatttgccttagggttaacaattgcaatg
gctgcaggagcagagccattacccatcaatggtgacaaatggcatcatatccgcaagggc
aactttccagagatttcccaagagctctcagatgacttttatggcctactcaagaacatg
atccacccagtcccagaggagagaccttccgcagcaactctggccagaagtcgaattctc
tggccctttctggagaagacagaagaactccagaaacaactgaatttagagaaatccaag
acagccacactgaaaagggaattgaaaaaagctcagcatatccacacccctcagagagac
gtccaccattgttatcaacagacctacaaaagctcaaggagcacaagacacctcctggtg
ggaggaaggaggaaggagcccccaagcttcacctgtggggcagcctctgtttag

DBGET integrated database retrieval system