KEGG   Rattus norvegicus (rat): 311144
Entry
311144            CDS       T01003                                 

Gene name
Itga4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04640  Hematopoietic cell lineage
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05165  Human papillomavirus infection
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    311144 (Itga4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    311144 (Itga4)
   04514 Cell adhesion molecules
    311144 (Itga4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    311144 (Itga4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    311144 (Itga4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    311144 (Itga4)
   04670 Leukocyte transendothelial migration
    311144 (Itga4)
   04672 Intestinal immune network for IgA production
    311144 (Itga4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    311144 (Itga4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    311144 (Itga4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    311144 (Itga4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    311144 (Itga4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    311144 (Itga4)
   05414 Dilated cardiomyopathy
    311144 (Itga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    311144 (Itga4)
   04515 Cell adhesion molecules [BR:rno04515]
    311144 (Itga4)
   04090 CD molecules [BR:rno04090]
    311144 (Itga4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   311144 (Itga4)
  Exosomal proteins of other cancer cells
   311144 (Itga4)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   311144 (Itga4)
CD molecules [BR:rno04090]
 Proteins
  311144 (Itga4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 311144
NCBI-ProteinID: NP_001101207
RGD: 1593249
Ensembl: ENSRNOG00000004861
Vega: OTTRNOG00000001285
Position
3
AA seq 1036 aa
MAAEAMCRPRPRGVALQEAVMLLLYFGVHFRVPTGHSYNLDPESALLYQGPSGTLFGYSV
VLHSHGTKRWLIVGAPTASWLANASVVNPGAIYRCRIGKNPNQICEQLQLGSPSGEPCGK
TCLEERDNQWLGVTISRQPGENGSIVTCGHRWKNIFYMKNNNKLPTGVCYGMPSDLRTEL
SKRMAPCYQDFVRKFGENFASCQAGISSFYTQDLIVMGAPGSSYWTGSVFVYNITTNKYK
AFVDRQNQVKFGSYLGYSVGAGHFRNPHTTEVVGGAPQHEQIGKAYIFSIDESELTIVYE
MKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGMGAVMVEMER
VLVGSDKYAARFGESMANLGDIDNDGFEDIAIGAPQEDDLRGAVYIYNGRVDGISSTYSQ
RIEGRQISQSLRMFGQSISGQIDADNNGYVDVAVGAFQSDSAVLLRTRPVVIVEASLSHP
ESVNRTKFDCTENGLLSVCVDLKLCFSYKGKEVPGYIVLFYNVSLDVHRKAESPSRFYFF
SNGTSDMITRSIRVSSSGEKCRTHQAFMRKDVRDILTPIQVEATYHLGHHVITKRNTEEF
PPLQPILQQKKEKDIIRKTINFARFCAYENCSADLQVSAKVGFLKPYENKTYLAVGSMKT
IMLNVSLFNAGDDAYETTLNVQLPTGLYFIKILDLEEKQINCDVTESSGVVKLACSLGYI
YVDRLSRIDISFLLDVSSLSRAHEDLSINVHASCENEGKLDQVKDNRVTLVIPLRYEVML
AVHGFVTPTSFVYGSSEENEPEMCMAEKLNLTFHVINTGISMAPNVSVKIMVPNSFLPRN
DKLFNVLDVQATMGQCQFEHYGRECALAQQKGIAGTLTDLVKFLSKTDKRLLYCMKADRH
CLDFLCNFGKMESGKEASVHIQLEGRPSVLEMDETSSLKFEIKATAFPEPHPKVIELNKD
ENIAHVYLEGLHHQRPKRHFTIVIVTISLLLGLIVLLLISCVMWKAGFFKRQYKSILQEE
NRRDSWSYVNSKSNDD
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggctgcggaagcgatgtgcagaccgaggccccgaggggtcgccctccaggaagcggtg
atgctgttgctgtacttcggggtacacttcagggtaccaaccgggcactcctacaacctg
gacccggagagtgcactgctgtaccagggcccctccggcacgctgtttggctactcggtg
gtgctgcacagccacgggacgaagcgctggctcattgtgggggcgcccactgccagctgg
ctcgccaatgcctcggtggtcaatcctggggcgatttacagatgcaggatcggaaagaat
ccaaaccagatctgcgaacagctccagctgggaagccccagtggagaaccctgtgggaag
acgtgcttggaagagagagataatcagtggctgggagtgacaatttccagacagccagga
gaaaatggatctatcgtgacttgtgggcacaggtggaaaaatatattttacatgaagaac
aataataaactccccactggtgtttgctatggcatgccttctgatttgcggacagaacta
agtaaaaggatggccccctgttaccaagattttgtgagaaaatttggagaaaattttgca
tcgtgtcaagctggaatatctagtttttacacacaggatttgattgtgatgggggccccg
ggatcatcgtactggaccggctccgtctttgtctacaacataactacgaacaaatacaag
gcatttgtagacagacagaatcaagtaaaatttggaagctacttaggctactcagtagga
gctggtcatttccgaaatccacatactaccgaagtcgtgggaggagcccctcaacacgaa
cagataggaaaagcatatatattcagcattgatgaaagcgaactgaccatcgtatatgaa
atgaaaggtaaaaagcttggctcttactttggagcttctgtctgtgcggtggacctcaat
gcagatggcttctcagatctccttgttggagcgcctatgcagagcaccatcagggaggaa
ggaagagtgttcgtgtacatcaactctggcatgggagctgtgatggttgaaatggaaaga
gtgctcgtcggaagtgacaaatatgctgccaggtttggggaatccatggcaaatcttggc
gacattgacaatgatggctttgaagatattgctattggcgcaccacaagaagatgacttg
cgaggcgctgtctacatttacaatggccgagtagatggcatctcctctacatactcacag
agaatcgaaggacgtcaaatcagccagtcactaaggatgtttggacagtctatctcagga
caaattgatgcagacaacaatggatatgttgatgtagcggttggtgcatttcagtctgat
tctgcagtgttgctaaggacacggcctgtagtgattgttgaagcatctttaagccatcct
gagtcagtaaatagaacaaaatttgactgtactgaaaatggacttctgtctgtgtgcgtg
gatcttaaactgtgtttctcatataagggcaaagaggtcccaggctacatcgttttgttt
tacaatgtgagcttggatgtgcacaggaaggccgagtctccgtcaagattttatttcttc
tccaatgggacttctgacatgattacaagaagcatacgagtttcaagcagtggagagaaa
tgtaggacacaccaggcattcatgcggaaagacgtgcgagacatcctcactcccattcag
gttgaggccacataccaccttgggcatcatgtgatcaccaaacgaaacacagaggaattc
ccacccctccagccgatccttcagcagaagaaagaaaaagacattattagaaaaacgata
aacttcgcaaggttttgtgcctatgaaaattgttctgctgatctgcaggtttctgcaaaa
gttgggtttttgaagccatatgaaaataaaacctatcttgctgttgggagcatgaagacc
ataatgctaaatgtgtccttgttcaatgctggagatgatgcttatgaaactactctgaat
gtccaactccccacaggcctttatttcattaagatcttagacctggaagagaaacaaata
aactgcgacgtgacagagagctcaggcgtagttaagcttgcctgcagcctcggttacata
tacgtggatcgtctctcaaggatagacattagctttctcctggatgtgagctcactcagc
agggcccatgaggacctcagcatcaacgtgcatgcctcctgtgaaaatgagggtaaattg
gaccaagtgaaagacaacagagtgaccttagtgatacctctaaggtatgaagttatgctg
gctgttcacgggtttgtgaccccaacttcgtttgtgtatggatccagtgaagaaaacgag
ccagaaatgtgcatggcagagaaattgaacctcactttccatgttataaacactggcatt
agcatggctccaaatgttagtgtgaaaataatggtaccaaattcttttctccctcgaaat
gataagttgttcaacgttttggatgtccaggcaactatggggcagtgccaatttgaacac
tatggacgagagtgtgcattagcacagcaaaaaggcatagcggggaccttgaccgatttg
gtcaaatttctatcaaagactgataagagactcctgtattgcatgaaagctgatcgacac
tgtttagatttcttatgtaatttcgggaaaatggaaagtgggaaggaagccagcgttcac
attcagctggaaggcaggccatccgtcttggaaatggatgagacctcatcgctcaaattt
gaaataaaagcaacagcttttccagagccacacccaaaagttattgagctcaataaggat
gagaacattgcccatgtttacttggaagggctccatcatcaaagacccaaacggcatttc
accatcgtgattgtcaccatcagcttgctccttggacttattgtacttttattaatttca
tgtgttatgtggaaggctggattttttaaaaggcagtacaaatctatcctacaagaagaa
aacaggagagacagctggagttatgtcaacagcaaaagcaatgatgactga

DBGET integrated database retrieval system