KEGG   Rattus norvegicus (rat): 312538
Entry
312538            CDS       T01003                                 

Gene name
Mcm2
Definition
(RefSeq) DNA replication licensing factor MCM2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    312538 (Mcm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    312538 (Mcm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    312538 (Mcm2)
   03036 Chromosome and associated proteins [BR:rno03036]
    312538 (Mcm2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     312538 (Mcm2)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    312538 (Mcm2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    312538 (Mcm2)
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_3 AAA_5 AAA_lid_2 AAA AAA_2 Sigma54_activ_2
Other DBs
NCBI-GeneID: 312538
NCBI-ProteinID: NP_001101343
RGD: 1305577
Ensembl: ENSRNOG00000016316
UniProt: D3ZP96
Position
4
AA seq 905 aa
MAESSESFSAASSPAPQRRRISDPLTSSPGRSSRRADALTSSPGRDLPPFEDESEGLLGT
EGPVEEEEDGEELIGDGMERDYRPIPELDVYEAEGLALDDEDVEELTASQREAAERAMRQ
RDREAGRGLGRMRRGLLYDSDEEDEERPARKRRHIERATEDGEEDEEMIESIENLEDLKG
HSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAA
REHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQ
LHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFILGPFCQSQNQEVKPGSCPECQSTG
PFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYH
NNYDGSLNTTNGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFA
SIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKV
SSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTS
IHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDV
LCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTTEPAMPNTYGVEPLPQEV
LKKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHAR
MHLRDYVMEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNDLLLFILKQL
VAEQVTYQRNRFGAQQDTIEIPEKDLMDKARQINIHNLSAFYDSDLFKINKFSRDLKRKL
ILQQF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggcggagtcttctgagtccttctcggcagcatctagccctgcccctcagcggcgacgg
atcagtgatcccctcacttccagcccaggccgcagctccagacgtgctgacgctcttacc
tccagccctggcagagacctccccccatttgaggatgagtccgaggggctgctgggcacg
gaggggcctgtggaggaagaagaggatggagaggaactcattggtgatggcatggagaga
gactaccgtcccattcccgagctcgatgtctacgaggcagagggattggccctggatgat
gaagatgtggaggagctgacagccagtcagagggaggcagctgagcgggctatgaggcag
cgggaccgtgaggctggcagaggcctgggtcgcatgcgtcgtgggctgctgtatgacagc
gacgaagaagatgaggagcggcctgcccgtaagcgccgccacatagagcgtgccacagag
gatggcgaggaggatgaagagatgattgagagtattgagaacctggaggacctcaagggc
cactcggtgcgagagtgggtgagcatggcagggcccagactggagatccaccaccgtttc
aagaacttcttgcgcacccacgtggacagccatggccacaacgtcttcaaggagcgtatc
agtgatatgtgcaaagagaaccgggagagtttggtggtaaattatgaagacctggcagcc
cgggaacatgtgttggcatacttcctacccgaggcacccgctgagctgctgcagatcttc
gatgaggctgccctggaggttgtgctggccatgtaccctaaatatgaccgcatcaccaac
cacattcacgtgcgcatctcccacctgcctctggtggaggagctgcgttcactgaggcag
ctacacctgaaccagctcatccgtaccagcggtgtggtgaccagctgcactggagtcctg
ccccagctcagcatggtcaagtataactgtagcaagtgcaactttatactggggcctttc
tgccagtctcagaaccaggaggtgaagcctggttcctgccctgagtgccagtcaactggg
ccctttgagatcaacatggaggagaccatctatcagaactaccaacggatccgcatccag
gagagtcccggcaaggtggcagctggccggctgccccgttccaaggatgccatcctcctt
gctgatctggtggacagctgcaagccaggagacgagatagagctgaccggcatttaccac
aataattatgatggctcacttaacaccaccaacggctttcccgtcttcgccaccatcatc
ctggccaaccacgttgccaagaaggacaacaaagtggccgtgggtgagctcactgatgag
gacgtgaagatgatcaccagtctttccaaggatcagcaaatcggagagaagatctttgcc
agcattgcgccctccatctatgggcatgaagacatcaagagaggcctggctctggctctg
tttggaggggagcccaagaacccaggtggaaagcacaaagttcgaggtgacatcaatgtg
ctcctgtgtggggaccctggcacagcgaagtcccagttcctcaaatacatcgagaaagta
tctagccgtgccattttcaccaccggccagggtgcgtcagccgtgggtctcacagcgtat
gttcagcggcatcctgtcagcagagagtggaccttagaggctggagccctggttctggcc
gaccggggagtgtgtctcattgatgagtttgacaagatgaatgaccaggacaggaccagc
atccacgaggccatggagcagcaaagcatctccatctccaaggccggcatcgttacctca
ctgcaagcccgctgcaccgtcatagctgctgccaaccccataggaggccgctacgaccct
tcactgaccttctcagagaatgtagacctcacagagcccatcatttcccgctttgatgtc
ctgtgtgtggtgagggacactgttgatcctgttcaggatgagatgctggcccgctttgtg
gttggcagccacgtcagacaccaccccagcaacaagaaggacgaagggctgaccaacggt
ggcaccacagagccagccatgcccaacacatacggtgtggagcccctgcctcaggaggtc
ctgaagaagtatatcatctatgccaaggaacgggtccgcccaaagctcaaccagatggac
caggacaaagtggccaggatgtacagcgacctgaggaaggagtccatggcaacgggcagt
attcccatcacagtgcgacacatcgagtccatgatccgcatggcagaggcccatgcacgc
atgcacctgcgagactacgtgatggaagatgatgtcaacatggccatccgcgtgatgctg
gagagcttcattgacacccaaaagttcagtgtcatgcgcagcatgcgcaagacttttgcc
cggtatctctccttccgtcgggataacaatgacctgctgctcttcatactgaagcagttg
gtggctgagcaggtgacataccaacgtaaccgctttggggcccaacaggacaccatcgaa
atacctgagaaggacctgatggacaaggccaggcagatcaatatccacaacctgtccgcc
ttctacgacagcgacctcttcaaaatcaacaagttcagccgtgacctgaaacgcaagctg
atcctacagcagttctga

DBGET integrated database retrieval system