KEGG   Rattus norvegicus (rat): 313304
Entry
313304            CDS       T01003                                 

Symbol
Stag2
Name
(RefSeq) cohesin subunit SA-2
  KO
K06671  cohesin complex subunit SA-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313304 (Stag2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313304 (Stag2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    313304 (Stag2)
SSDB
Motif
Pfam: STAG Cnd3 AdoHcyase_NAD MyTH4
Other DBs
NCBI-GeneID: 313304
NCBI-ProteinID: NP_001166978
RGD: 1562042
Ensembl: ENSRNOG00000029885
UniProt: D3ZXT2
Position
X
AA seq 1231 aa
MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKSGNGG
GKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINF
FIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG
VLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIN
MDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA
IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKEL
NSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA
HRPVAVAAGEFLYKKLFSRRDPEEDGIMKRRGRQGPNANLVKTLVFFFLESELHEHAAYL
VDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVG
RGTGKRVLTAKEKKTQLDDRTRITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIY
TTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDE
LADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGI
ENGDMPEQIVIHALQCAHYVILWQLAKITESTSTKEDLLRLKKQMRVFCQICQHYLTNVN
TTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD
SNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDII
KETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFG
LDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYV
YLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGMSSRGSTVRSKKSKPSTG
KRKVLEGMQLALPEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMS
VYPMQTEHHQTPLDYNQRGTSIMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPP
SKNRRERTELKPDFFDPASIMDESVLGVSMF
NT seq 3696 nt   +upstreamnt  +downstreamnt
atgatagcagctccagaaataccaactgattttaatctactgcaggagtcagaaacacat
ttttcttctgacacagattttgaagacattgaaggaaaaaatcagaagcaaggcaaaggc
aaaacttgtaaaaaaggcaagaagggtccagcagagaagggtaaaagtggaaatggagga
ggaaaacctccttctggtccaaaccgaatgaatggtcatcatcagcagaatggagttgaa
aacatgatgttgtttgaagttgtaaaaatgggcaagagtgctatgcagtcggtggtagat
gattggatagaatcatacaagcatgaccgagatatagcacttcttgaccttatcaacttt
tttattcagtgttcaggctgcaaaggagtcgtcacagcagagatgtttagacatatgcag
aactctgagataattcgaaaaatgacagaagaattcgacgaggatagtggggattaccca
ctaaccatggctggtcctcagtggaagaagttcaagtccagcttctgtgagttcattggt
gtattagtacggcaatgtcaatatagtatcatatatgatgagtacatgatggacactgtc
atttcacttcttactggattgtctgactcccaagtcagagcatttcgacatacaagcacc
ctggcagctatgaagttgatgactgctttggtaaatgtggcactaaatcttagcattaat
atggataacacacaaagacagtatgaggcagaacggaataaaatgattggaaaacgagcc
aatgaaaggctagaactcctgttacaaaagcgtaaagagcttcaggaaaatcaagatgaa
atagaaaatatgatgaatgcaatatttaaaggagtgtttgtacatagatacagggatgca
atagctgaaatcagagctatatgcattgaagagattggcatttggatgaagatgtatagt
gatgccttccttaatgacagctatttaaaatatgttggttggactatgcatgataagcaa
ggtgaggtaagactcaagtgtcttactgctttacaagggctttactataacaaagagctt
aactccaaactggaactgtttaccagtcggttcaaggatagaattgtgtctatgaccctt
gacaaagaatatgatgttgcagtacaagcaataaagttactcactcttgttttacagagt
agtgaagaagttctaactgcagaagactgtgaaaatgtctatcatctggtttattcagct
caccggccagtagcagttgcagctggagaatttctctacaaaaagctcttcagccgtaga
gatccagaagaggatggaataatgaaaagaaggggaagacaaggtccaaatgccaatctt
gtcaagactttggtgtttttcttcttggaaagtgagttacatgaacatgcagcatacctt
gtggatagcatgtgggattgtgctactgagctactgaaagactgggaatgtatgaatagc
ttgttattagaggagcctctcagtggagaggaagctctaacagacagacaagagagtgct
ttgattgaaataatgctttgtactattagacaagcagctgaatgtcatccgcctgtggga
agagggacaggaaaaagggtgctaacagcaaaggagaagaagacacagttggatgacaga
acaagaatcactgagctgtttgctgtggcccttccacaattattagcaaaatactctgta
gatgcagaaaaggtgaccaatttgttgcagttacctcaatactttgacttggagatctac
accactggacgattggaaaagcacttggatgccttattgcgtcagatccgaaatattgta
gagaagcacacagacacagatgttttggaagcatgttctaaaacttaccatgcattatgt
aatgaagagttcacgatcttcaacagagtagatatttcaagaagtcagctgatagatgaa
ctggcagataaatttaaccggcttctggaagattttctgcaagagggagaagaacctgac
gaagatgatgcatatcaggtattgtcaacattgaagaggatcactgcttttcataatgcc
catgatctttcaaagtgggatttgtttgcttgtaattacaaactcttgaaaaccggaatt
gaaaatggagatatgcctgagcagatcgttattcacgcactgcagtgtgctcactatgta
atcctttggcagcttgctaagatcactgaaagcacttctacaaaggaggacttgctgcgt
ttaaagaaacagatgagggtattttgccagatatgtcaacattacttaaccaacgtgaat
actactgttaaggaacaggccttcactattctgtgtgatattttgatgatcttcagtcac
cagattatgtctggagggcgtgacatgttagagccattagtttatactcctgattcttca
ttgcagtctgagttgctcagctttattttggatcatgtcttcattgaacaggatgatgat
agtaatagtgcagatggtcagcaggaggatgaagccagtaaaattgaagctttgcataag
aggagaaatttacttgcagcattttgtaagctaattgtatatacagtggtggagatgaac
acagctgcggatatcttcaagcagtatatgaagtattataacgattatggcgatatcatc
aaagaaacaatgagtaaaacaaggcagattgacaaaattcagtgtgccaagactcttatt
ctcagtttgcagcagctttttaatgagatgatacaagaaaatggctataactttgataga
tcatcctcaacatttagcggcataaaagaacttgctcgacgttttgctttaacttttgga
cttgatcagttgaaaaccagagaagccattgccatgctgcacaaagatggcatagaattt
gcttttaaggagcctaatccacaaggggagagccatccacctttaaatttggcatttctt
gatattctcagtgaattttcttctaaactgctccgacaagataaaagaacagtgtatgtt
tatttggaaaagttcatgacctttcagatgtcactccgaagagaagatgtatggcttcct
ctgatgtcttaccgaaattctttgctagctggtggtgatgatgacaccatgtcagtcatt
agtggaatgagcagtcggggatcaactgtacggagtaaaaaatcaaaaccatctacaggg
aaacggaaagtgcttgaaggcatgcaactagcactccctgaagaaagcagtagcagtgac
agtatgtggttgagcagagagcagacactgcacacccctgttatgatgcagacaccgcag
ctcacctccactattatgagagaaccgaaaaggttacggcctgaagatagcttcatgagt
gtctatccgatgcagacagaacaccatcaaactcctctggattacaatcagcgtggtaca
agcataatggaggatgacgaagagccgattgttgaagatgttatgatgtcctcagaagga
aggattgaggatcttaatgagggaatggactttgacaccatggatatagacctgccacca
tcaaagaatagaagagagagaacagaactgaagcctgatttctttgatcctgcttcaatt
atggatgaatcagttcttggcgtgtcaatgttttaa

KEGG   Rattus norvegicus (rat): 315958
Entry
315958            CDS       T01003                                 

Symbol
Stag1
Name
(RefSeq) cohesin subunit SA-1
  KO
K06671  cohesin complex subunit SA-1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    315958 (Stag1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    315958 (Stag1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    315958 (Stag1)
SSDB
Motif
Pfam: STAG RFX5_DNA_bdg Cnd1 Mlh1_C
Other DBs
NCBI-GeneID: 315958
NCBI-ProteinID: NP_001101649
RGD: 1310744
Ensembl: ENSRNOG00000015389
UniProt: D4A3Q2
Position
8
AA seq 1122 aa
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGVGRGRANGHPQQNGEGDPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKYYNDYGDIIKETLSKTRQIDK
IQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVAT
LHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMME
RREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRSKKGRPPLHRKRAEDESLDN
TWLNRTDTMIQTPGPLPTPQLTSTVLRENSRPMGEQIQEPESEHGSEPDFLHNPQMQISW
LGQPKLEDLNRKDRTGMNYMKVRAGVRHAVRGLMEEDAEPIFEDVMMSSRSQLEDMNEEF
EDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgattacttcagagttaccagtgttacaggattcaactaatgaaactactgcccattct
gatgctggcagcgaacttgaagaaacagaggtcaaaggaaagagaaaaaggggtcgtcct
ggccggcctccatcaacaaataagaaacctcgaaaatctccaggagaaaagagcagaatt
gaagctggaattagaggagtgggtcgcggaagagctaatgggcaccctcaacagaacggc
gaaggggatcccgtcaccttatttgaggtggtgaagctggggaagagtgcaatgcagtct
gtggtggatgactggattgaatcatataaacaagaccgggacatcgcacttctggattta
atcaacttttttatccagtgttcaggatgtcgaggtactgtcagaatagagatgtttcga
aatatgcagaacgcagaaataatcagaaaaatgactgaagaatttgatgaggacagtggt
gactacccccttaccatgcctggtcctcagtggaaaaaatttcgttccaatttttgtgaa
tttattggagtcctgattcgacagtgtcaatatagcataatttatgatgaatatatgatg
gacaccgtaatttcccttttgactggtttgtcagactcccaggtcagagcttttaggcat
acaagtacccttgctgcaatgaagctgatgactgctctggtgaatgttgccttaaacctc
agtattcatcaggataatacacagaggcaatacgaagccgagagaaataaaatgattggg
aagagagccaatgaaaggctggagttactacttcagaaacgtaaagagctacaagaaaat
caagatgaaattgaaaatatgatgaactctatttttaagggtatatttgttcatagatac
cgtgatgcaattgctgaaattcgagccatctgtattgaagaaattggagtatggatgaaa
atgtatagcgatgccttcctcaatgacagttacctgaaatatgtaggatggactcttcat
gataggcaaggtgaagtcagactgaagtgtttgaaagctctacaaagcctgtataccaat
agagaattattccccaaattggagctgtttactaatcgattcaaggatcgcattgtatca
atgactcttgacaaagaatatgatgttgctgtggaagccatccggttggttactctgata
cttcatggaagtgaagaagctctttccaatgaagactgtgaaaacgtctaccatttggtg
tactcagcacatcgccctgttgctgtggcagctggagagtttctgcacaaaaagctgttt
agcagacatgacccacaagctgaggaagcattagcaaagagaagaggaagaaacagtcca
aatgggaacctcattaggatgcttgttcttttctttcttgaaagtgagttacatgaacat
gcagcctacttggtggacagcttgtgggagagctctcaagaactgttgaaagactgggaa
tgtatgacagagttactattagaagaacctgttcaaggagaggaagccatgtctgaccgt
caggagagcgctcttatagagctaatggtctgtacaattcgtcaagcagctgaggcacat
cctccagtgggaaggggaaccggcaagagagtgctaacagccaaagaaaggaaaactcaa
attgatgatagaaataaattaactgaacattttatcattacacttcctatgttactatca
aagtattctgcagatgcagagaaggtagcgaacttgctgcagattccacagtattttgat
ctggaaatctacagcacaggtcggatggaaaagcacctggatgctttattaaaacagatt
aagtttgttgtagagaaacatgtagagtcagatgtcctagaagcctgcagtaaaacctac
agcattttatgcagtgaagagtacaccattcaaaatcgagtcgatattgctcggagccag
ctcattgatgaatttgtagatcgattcaatcattctgtagaagacctattgcaagagggt
gaagaagctgatgatgatgatatctacaatgttctttccaccttaaagcgtttaacttct
tttcacaatgctcatgatctcactaaatgggatctgtttggtaattgctacagactattg
aagactggaattgaacatggagctatgccagaacagatagtcgtacaagcactgcagtgt
tcccattactcaattctttggcagctggtgaaaattactgatggttctccttccaaatat
tacaatgactatggtgatattattaaggaaaccctgagtaagaccaggcagattgataag
attcagtgtgctaagactctcattctcagtctacaacagttgtttaatgaacttgttcaa
gaacaaggtcctaatctggataggacatcggcccatgtcagtggaattaaagaactggca
cgtcgttttgcccttacatttggattggaccagatcaagacccgagaagcagttgccaca
cttcacaaggatggaatagagtttgcctttaaataccagaatcagaaaggacaagagtat
ccacctcctaatctggcttttcttgaagtactaagtgaattttcttctaaactccttcga
caggacaagaaaactgtccattcctatcttgaaaaattcctcactgagcagatgatggaa
aggagggaggatgtatggcttccactcatctcgtatagaaattcgttagtcactgggggt
gaagacgacagaatgtctgtgaacagtggaagtagcagcagtaaaacttcctcagtgcgc
agtaagaaaggaagacccccactgcacagaaaacgagcagaagatgaaagtctggataac
acatggctaaataggactgacacaatgattcagactcctggacccttgccaaccccacag
ctcacctccactgtacttagagagaacagccgtcccatgggagagcagattcaggagcct
gagtctgagcatggttctgaaccagactttttacacaatccccagatgcagatctcttgg
ttaggccagccgaagttagaagacttgaatcggaaggacagaacaggaatgaactacatg
aaagtgagagctggagtaaggcatgctgttcggggtctaatggaggaagatgctgagccc
atctttgaagatgtgatgatgtcatcacggagccagttagaagacatgaatgaagaattt
gaagacaccatggttattgatttgcccccatcaagaaatcggcgagagcgagctgagcta
aggccagacttctttgactctgcagctatcatagaagatgattcaggatttggaatgcct
atgttctga

DBGET integrated database retrieval system