KEGG   Rattus norvegicus (rat): 313658
Entry
313658            CDS       T01003                                 

Gene name
Ubr4
Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    313658 (Ubr4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    313658 (Ubr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    313658 (Ubr4)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     313658 (Ubr4)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    313658 (Ubr4)
SSDB
Motif
Pfam: E3_UBR4_N E3_UbLigase_R4 zf-UBR Ribosomal_L30 AP3D1 DUF4820
Other DBs
NCBI-GeneID: 313658
NCBI-ProteinID: NP_001034115
RGD: 1563121
Ensembl: ENSRNOG00000018183
UniProt: Q2TL32
Position
5
AA seq 5194 aa
MATSGGEEAAAAAPAPGAPATGQDTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIESE
SEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPDE
ACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPV
SPELRQKEVQMNFLNQLTSVFNPRTVPSPPISPQALVEGENDEQSSTEQASAVKTKNVFI
AQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVVANSFFIMPATVADATAVRNGFH
SLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVRT
GSTSSKEEDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHFQNFQLLGAWCLLNSLFL
ILHLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANHA
IKLLTSLFQDLQVEALHKGWETDGPPAVLSIMAQSTSTQRVQRLIDSVPLTNLLLTLLST
SYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETIS
PSKEKAAPPPPPPPPPLESSPRVKSPSKQASGEKGNILASRKDPELFLGLASNILNFITS
SMLNSRNNFIRNYLSVSLSEQHMATLASIIKEVDKDGLKGSSDEDFAAALYHFNHSLVTS
DLQSPNLQNTLLQQLGVAPLSSGPWPLYIHPQGLSVLSRLLLIWQHKAGAQGDPDVPECL
KVWDRFLTTMKQSALQGVVPSETEDLNIEHLQLLLLIFHSFSEKGRRAILTTLVQSIQEL
SVNMEVQMRSAPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDSSS
SSRRANIPLYHGFKEVEENWSKHFSSDAAPQPRFYCVLSTEASEEDLNRLDSEACEVLFS
KLVKYDELYSSLTALLAAGSQLDTVKRKENKNMTALEACALQYYFLILWRILGILPPSKT
YMNQLAMNSPEMSECDILHTLRWSSRLRISSYVSWIKDHLIRQGMRPEHAGSLVELAASK
CSSVKYDVEIVEEYFARQISSFCSIDCTTVLQLHEIPSLQSIYTLDAAVSKVQVSLDEHF
SKMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNLNEEGSTEKPSQEKLHGFA
AVLAIGSSRCKANTLGPTLVQNLPSSVQSVCESWNNINTNEFPNIGSWRNAFANDTIPSE
SYISAVQAAHLGTLCGQSLPLAASLKHALLSLVRLTGDLIVWSDEMNPAQVIRALLPLLL
ESSTESAAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPSSGLDESVLEE
CLQYLEKQLESSQARKAMEEFFSDGGELVQIMMATANEDLSAKFCNRVLKFFTKLFQLTE
KSPNPSLLHLCGSLAQLACVEPVRLQAWLTRMTTSPPKDSDQLEVIQENRQLLQLLTTYI
VRENSQVGEGVCAVLLGTLTPMATDMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNA
AVDWLGRCKKYLSQKNVVEKLNANVMHGKHVMVLECTCHIMSYLADVTNALSQSNGQGPS
HLSVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHC
HTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSST
MKESAFQSEPRVSESLVRHASTSPADKAKVTISDGKVADEEKPKKSSLCRTVEGCREELQ
NQANFSFAPLVLDMLNFLMDAIQTNFQQASAVGSSSRAQQALSELHTVDKVVEMTDQLMV
PTLGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGK
ITVLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTF
SSSGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFL
LPSSKIRDVTFLFNEEGKNIIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDLK
DSNSQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATVSRSTLEVLQLFPINIKSSNGGSKT
SPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHT
ACNEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATITAR
TSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTMEI
SNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADRK
LNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSSVCPPNLNQSNSTG
DSDSAAPATTSGTVLERLVVSSLEALESCFAVGPIIEKERNKHAAQELATLLLSLPAPAS
VQQQSKSLLASLHSSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSI
AVTRPNNLVHFTESKLPQMETEGAEEGKEPQKQVEGDGCSFITQLVNHFWKLHASKPKNA
FLAPACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQX
LIRVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPDGGHIRQESQEQS
EVDHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAI
ALSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASGVCACNSSVTLSAPAS
DDEGSTAATDGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPA
GPGSVSSSTGAISTTTGHQEGDGSEGEGEGEAEGDVHTSNRLHMVRLMLLERLLQTLPQL
RNVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLIAELGMDKKDVSKKNERSAL
NEVHLVVMRLLSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLEY
WKGQQSEEEPVTTSQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLP
YQIKKIADTSSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLR
DLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTI
NWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASTGSSSVASS
APPAASSGQTTTQSKSSTKKSKKEKKEKEKEGESSGSQEDQLCTALVNQLNRFADKETLI
QFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFV
DLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLES
DPCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRT
INLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYE
NYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYA
RFDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNE
AAPEKPQEDSGTAGGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELL
EYDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRA
LATNPALRHILVSQGLIRELFDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIG
KVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVV
ENITLMCLRILQKLIKPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYE
AWKKCLPIRGVDGNGKSPSKSELHRLYLTEKYVWRWKQFLSRRGKRTTPLDLKLGHNNWL
RQVLFTPATQAARQAACTIVEALASVPSRKQQVLDLLTSYLDELSVAGECAAEYLALYQK
LIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFV
EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAF
MAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPG
NPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVW
CTTNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCML
NRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQE
SKDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSN
PSVLQGLLRIIPYLSFGEVEKMQILVERFKPYCSFDKYDEDHSGDDKVFLDCFCKIAAGI
KNNSNGHQLKDLILQKGITQSALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGL
AMQHPATQVLIGTDSITSLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETR
AEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQP
TKVLGIYTFTKRVALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAAL
QNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFA
MEQSFSADTGGGGRESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPREKWTESA
FDVDGPHYFTILALHVLPPEQWKATRVEILRRLLVASHARAVAPGGATRLTDKAVKDYSA
YRSSLLFWALVDLIYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEF
MPVETFSEFLDAAGLLSEITDPESFLKDLLNSVP
NT seq 15585 nt   +upstreamnt  +downstreamnt
atggcgacgagcggcggcgaagaggcggcggcagcagctccagcgcccggagccccggca
accgggcaggacacgaccccgggctgggaggtggcggtgcggcccctactgtccgcgtcc
tactccgccttcgagatgaaggagttgccgcagctggtggcctcagtcatcgagagtgag
tcagagatcctgcaccacgagaagcagtacgagccattctattcatcctttgtcgcactg
tccacgcactacatcaccacggtctgcagcctcattccccggaaccagcttcagtcggtg
gcggctgcctgtaaagtcctcattgagttttccctcctgcggctggagaacccggacgag
gcctgtgctgtgtcccagaaacacttgattctgctgataaaaggcctgtgcactggctgt
agccgactagacagaacagagattatcacctttacagcaatgatgaaatccgccaagctt
ccacagacagtgaagacgctttcagatgtggaagaccagaaagagctggcttcaccagtg
agccccgagctgaggcagaaggaggtacagatgaactttttgaaccagctgacctcagtt
tttaaccctagaaccgtaccgtctcctcccattagtccacaggctctggtggaaggagaa
aatgatgagcagtcctccacagagcaggcctctgctgtcaagaccaagaatgtgttcata
gctcagaatgtggctagccttcaagagcttgggggctctgagaagttactccgagtatgc
ctgaacctgccctacttcctgcgctacatcaatcggtttcaggatgctgtggtggccaat
tccttcttcatcatgcctgcaacagtagctgatgccaccgctgttcgaaatggttttcac
tcactggtgattgatgtaaccatggccttggataccctttccctacctgtgctggaaccc
ctcaatccttctcgtttgcaagatgtgacagtgctcagcctcagctgtctttatgcaggt
gtgagtgtggccacctgcatggccattcttcatgtggggagtgcccagcaagtgcggaca
gggtccaccagctccaaagaagaagactacgaaagtgatgcagccaccattgttcagaaa
tgtcttgagatctatgacatgattggacaggccatcagcagttcccgccgcgccggtggt
gagcacttccagaacttccagctgctgggtgcctggtgtctgctcaatagcctcttcctc
atactgcatctcagtcccacagccctggctgacaaagggaaagagaaggacccgttggct
gccctccgagtcagagacatcctttctcgtacaaaggagggagtaggctctcccaaactg
gggcctggcaaagggcatcagggatttggggtactctcagtgatactggcaaaccatgcc
atcaagctgctgacatctctctttcaagacctgcaggtggaggcgctccacaagggctgg
gagacagatggtccccctgcagtcctgagtattatggcccagagtacctccacacaaagg
gttcagcggctgattgactctgtccctctgacaaacctgctcttgacgctgctttccact
tcatacagaaaggcatgtgtcctgcagcggcagaggaagggctccatgagcagtgacgcc
agtgcctccactgactccaacacctactatgaagacgacttcagtagcactgaggaggat
agcagccaagatgatgacagtgagccaattttggggcagtggtttgaggagaccatctct
cccagtaaggaaaaagctgcgcctccaccccctcccccgccccctcccctggagagctct
cctcgggttaaaagccccagtaaacaggcgtctggtgagaagggcaacatcttggccagt
cgcaaagatcctgagttgttcttaggtctggcttccaacatcctgaactttatcacctct
tccatgctgaactctcggaacaatttcatccggaactatctgagcgtgtctctttccgag
cagcacatggccaccttggccagcatcattaaggaggtggacaaagatggactcaagggg
tcatcggatgaggactttgctgctgctctctaccacttcaaccactccctggtgacctcc
gacctacagtccccgaacctgcagaatacactgctacagcagctgggagttgctcctctc
tcctcaggcccttggcccctctacattcacccccaaggcctctctgtgctttcccgcctc
ctgcttatctggcagcataaagctggagcacaaggtgaccctgacgtccctgaatgcctg
aaagtgtgggacaggttcttgaccacaatgaagcagagtgcactgcagggggtggtgccc
agtgagaccgaagacctgaacatcgagcacctgcagctgctgctgctcatcttccacagc
ttctctgagaagggccgccgggccatcttgaccacactggtgcagagcatccaggagctg
agtgttaacatggaggtgcagatgcgctctgccccgctgattctggcccgcctcctcttg
atcttcgactacctacttcatcagtactccaaagcccctgtgtatctgtttgagcaggtg
caacacaacctgctaagccccccttttgggtgggcaagtggatcccaagacagcagcagc
agcagccgccgagccaacattcctctgtatcatgggttcaaggaagtcgaagaaaattgg
tccaaacatttttcatcagatgcagccccacaacccaggttctactgtgtcctgtccact
gaggcctccgaggaagatttgaaccggctggattctgaggcatgtgaagttcttttctcc
aagcttgtcaagtacgatgaactatattcttcactgactgccctgcttgcggctgggtct
cagcttgatacagtcaagaggaaggaaaataagaacatgacagccctggaggcctgcgcc
ctgcagtattacttcttgattctctggaggatcttgggaattttaccgccttcaaagact
tacatgaaccaactggccatgaactcacctgagatgagcgaatgcgacatcttacacact
ctgcggtggtcgtcccgcctccggatcagttcctatgtcagctggataaaggatcacctt
atcagacaaggcatgaggcccgagcatgcgggctcgcttgttgagctggccgccagcaag
tgcagttcagtgaagtacgatgtcgagatcgtagaggagtactttgcccgacagatctcg
tcattctgctccattgactgcaccactgttctccagctgcatgagatccctagtctgcag
tccatctacaccctggacgcagctgtctcaaaggtgcaggtctctctggatgagcacttt
tctaagatggctgcagagaccgaccctcataagtcatctgagatcaccaagaacctcctt
ccagccacgctgcagctcattgacacctacgcctcattcacaagagcctatctgcttcag
aaccttaatgaagagggatccactgagaagccctcccaggagaagctgcatggctttgca
gcagtcttggctatcggctcgagtaggtgcaaggcaaacacactgggtccaactctggtg
cagaatttaccgtcatcagtgcaatcggtctgtgagtcctggaataacatcaataccaac
gagtttcccaacattggatcctggcgcaatgcatttgccaacgacaccatcccatcggag
agttatatcagtgcagtgcaggctgctcacctggggactctgtgtggccagagtctgccc
ctggcggcttccctgaaacatgccctcctctccctggtcaggttgactggggatctgatt
gtgtggtcggatgagatgaacccagcgcaggtcatccgggctctgctaccgctccttttg
gagtcaagcacagagagcgctgctgagatcagcagtaactccctggagcgcatcttggga
cctgcggagtctgatgagttcctggctcgcgtgtatgagaagctgatcacagggtgttac
aacattctggccaaccacgcagaccccagcagtgggctggatgagtccgtcctggaggag
tgtttacagtatctggagaagcagctggagagcagccaggcccggaaggccatggaggag
tttttctctgatggtggggaacttgtgcagatcatgatggccacggccaatgaggacctc
tctgctaaattctgtaaccgagtcttgaaattcttcaccaaactcttccaactgactgag
aagagccctaacccaagcctccttcacctctgtggctctctcgcccagcttgcctgtgtg
gagccagtacgcctgcaggcctggctcacccgcatgacaacatcgcccccaaaggattct
gaccagctggaggtcattcaggagaaccggcagctgctacagttactgaccacgtacatt
gttcgggaaaacagccaagttggagaaggtgtgtgcgctgtacttctgggcactctgacc
cccatggccacagacatgctggcgaatggtgatgggaccggcttccccgagctcatggtt
gtgatggccactttagccagtgccggacaaggagcgggccaccttcaacttcacaatgct
gctgtggactggctgggcagatgcaagaaatacctgtcacagaagaatgtggttgagaaa
ctgaatgccaatgtaatgcatggaaagcatgtgatggtcttggaatgcacatgtcacatt
atgtcttacctggctgacgtcacgaatgccctgagccagagtaatggtcaaggaccgagc
catctgtcggtagatggggaggagcgtgccattgaggtggattcagactgggtggaagag
ttagcggtggaagaggaagactcccaggctgaggactccgatgaagattctctttgcaat
aagctgtgcactttcaccatcacacagaaggaatttatgaaccagcattggtaccactgt
catacatgtaagatggtggatggggtgggtgtgtgcacagtgtgtgcgaaggtgtgccac
aaggatcatgagatctcctatgccaagtatggctcctttttctgtgactgtggagccaag
gaagatggcagctgcttggcactggtgaaacgaactcctagcagtggcatgagctctacc
atgaaggagtcagcatttcagagcgagcctagggtttcagagagtctggtgcgccatgcc
agcacctcacctgctgacaaggccaaggtcaccatcagtgatggaaaggttgctgatgaa
gagaagcccaagaagagcagcctgtgccgcacagttgaggggtgccgtgaggagctgcag
aatcaggccaatttctccttcgctcctctcgtgttagacatgctcaatttcctcatggat
gccattcagaccaactttcagcaggcttccgccgtggggagcagcagccgggcacagcag
gccctcagtgaactgcacacagtggacaaggttgtggagatgacagaccagctgatggtt
cccaccttaggctcacaggaaggtgcctttgagaatgttcggatgaattacagcggagac
cagggccagactatacggcagctgatcagtgcccacgtgctcaggcgggtggctatgtgt
gtgctttcttccccccatgggcgccgccaacatttggctgtcagccacgagaagggcaag
atcacggtgctgcagctctcggcgctcctgaagcaagcagattccagtaagaggaagttg
actctaacccgcttggcttctgctccagttcccttcaccgtgctgagtcttactggaaac
ccctgcaaggaggactacctggcagtgtgtgggctgaaggactgccatgtgctcaccttc
agtagctcgggctctgtctccgatcacttagtgttacatccccagttggcaacagggaac
ttcatcatcaaagctgtgtggctccctggctctcagaccgagctagccattgttactgca
gacttcgtcaagatttacgacctgtctgttgatgccttgagccccaccttctacttcctc
ctgccaagctcaaagataagggatgtcaccttccttttcaacgaggaaggcaagaacatc
attgtcatcatgtcctctgctgggtacatgtacacacagctcatggaggaggccagcagt
gcccagcaggggcccttctatgtcactaatgtgctggaaataaatcacgaggatctgaag
gacagtaacagccaggtggcaggtggtggcgtgtctgtgtactattcacacgtgttgcag
atgcttttcttcagctacagtcagggcaagtcctttgcagccaccgtcagcaggagcact
ctggaggtgctgcagctcttccccatcaacatcaaaagctccaatggtggcagtaagact
tctcccgccctttgccagtggtctgaggtgatgaaccaccctggcttggtgtgttgtgtt
cagcaaactactggtgtgcctctggtagtcatggtgaaaccagacactttcctcatccag
gagattaagactcttcccgccaaagcaaagatccaggacatggttgctattagacacact
gcctgtaatgagcagcagcgcaccaccatgatcctgctgtgtgaggatggcagcctgcga
atttatatggccaacgtggagaacacctcttactggctccagccgtctctgcagcccagc
agcgtcatcagcatcatgaagcctgtgcgaaagcgcaaaacagctacaatcacagcccgc
acatccagccaggtgaccttccccattgacttctttgaacacaaccagcagctaacggat
gtggagtttggtggtaatgacctcctgcaagtctacaatgcgcaacagataaagcacagg
ctcaactccactggcatgtatgtggcgaacaccaagcctggaggcttcaccatggagatc
agtaacaacagtagcaccatggtgatgacgggcatgcggatccagattggcacacaggca
atcgagcgagcaccgtcctacatcgagatctttggcagaaccatgcagcttaacctgagc
cgctcccgctggtttgacttccccttcaccagagaggaagccctgcaggctgaccggaag
ctgaacctcttcatcggtgcctctgtggatccagctggcgtcaccatgatagatgctgta
aaaatttatggcaagactaaagagcagtttggctggcctgatgagcccccagaagacttc
ccttctgcctctgttagcagcgtctgccctcctaacctgaaccagagcaacagcactgga
gacagtgactcagctgctccagctacaaccagtggcactgtcctggagaggctggttgtg
agttctttggaagccctggaaagctgctttgctgtcggcccaatcattgagaaggagaga
aacaagcacgcagcccaggagctggccactttgttgctctccctgccagcgcctgccagc
gtccaacagcaatcaaagagcctcctggccagcctgcacagcagtcgctcggcctaccac
agccacaaggaccaggccttgttgagcaaagctgtgcagtgtctcaacacttccagcaaa
gaaggcaaggacttggaccccgaggtgttccagcgtctagtaatcacagctcgctctatt
gccgtcacacgtcccaacaaccttgtgcactttacggagtccaagctgccccagatggaa
acagaaggagcggaggaggggaaagagccgcagaagcaggtggaaggagacggctgtagt
ttcatcactcagcttgtaaaccacttctggaaactccatgcatctaagcccaagaatgcc
ttcctggcacctgcctgcctgccaggccttactcatattgaagctacggttaatgcgctg
gtagacattatccatggctattgtacctgcgagctggactgtatcaacacagcatccaag
atctacatgcagatgctgctgtgtcctgaccctgctgtnagcttctcctgtaaacaagnt
ctaattcgagtcctaaggcccaggaacaagcggagacacgtgacattgccctcctccccc
cgaagcaacactccaatgggagacaaggatgacgatgatgatgatgatgcggatgagaaa
atgcagtcatcgggcatccctgatggtggtcacatccgtcaggaaagccaggagcagagt
gaggtggaccatggagattttgagatggtgtctgagtcgatggtcctggaaacagctgaa
aatgtcaacaatggcaacccctctcccctggaagccctgctggccggtgctgagggcttt
cctcccatgctggacatcccacctgatgcagacgacgagaccatggttgaactagccatt
gccctcagcctncagcaggaccagcaaggcagcagcagcagtgccctgggccttcagagc
ctgggactgtcgggccaggcacccagctcttcctctctggacgcaggaaccctctctgac
accacagcatcaggggtctgtgcctgtaacagctctgttactctctcagctccagcctca
gatgacgagggcagcactgcagcaactgatggctccaccctgcggacctcgccagccgac
catggcggtagtgtgggctcagagagcgggggaagtgcagtggactcggtggctggcgag
cacagtgtgtctggccggagcagtgcatatggtgacgccacagctgaggggcacccggct
ggaccagggagcgtcagctctagcacaggcgccatcagcaccactactgggcaccaggag
ggagatggatctgagggagaaggagaaggggaagctgaaggagatgtgcacactagcaac
aggctacacatggttcgtctaatgctgttggaaagattactgcagacactgccccagtta
cggaatgtcggaggtgtccgggccatcccatacatgcaggtcattctcatgctcactaca
gatctggatggagaagatgagaaagacaagggagccctggacaacctgcttgcacagctc
attgctgagctgggaatggacaaaaaggatgtctccaagaagaatgaacgcagtgccttg
aacgaagtccatttggtcgtgatgagactcctgagtgtcttcatgtcccgcaccaagtct
ggatccaaatcttccatctgtgagtcgtcttccctcatctccagtgccacggcagcagcc
ctgctgagctccggggccgtggactattgcctccatgtgctcaagtctctgctggaatac
tggaagggccagcagagtgaggaggagcctgtgaccaccagccaattgctgaaaccacac
acgacctcatctccaccagatatgagcccgttctttctccgacaatatgtgaagggtcat
gctgctgatgtgttcgaagcctatacccagctgctcacagaaatggtactgaggcttccc
taccagatcaagaagatcgcagataccagctctcgaatccctcctcctgtctttgatcac
tcctggttctactttctctctgagtacctaatgatccagcagaccccttttgtccgccgc
caagtccggaaacttctgctcttcatctgtggatcaaaggagaaataccgtcagctccga
gacctgcacaccctggactcccatgtgcgtgggatcaagaagctgctggaggaacaaggc
atcttcctcagggccagcgtggttacagccagttccggctccgctttgcagtatgacacg
ctcatcagcctgatggagcacctgaaggcctgtgcagagattgccgcccagcgcaccatc
aactggcagaagttctgcatcaaagatgactctgtcctgtacttcctcctgcaagtgagt
ttcctggtagatgagggggtgtcccctgtgctactgcagctgctttcctgtgctctttgc
ggcagcaaagtgctcgcagccctggcggcctccacgggctcctccagtgtggcttcctca
gcccctcctgcagccagttctggacaaaccacaactcagtccaaatcctccactaaaaag
agcaagaaagaaaaaaaggagaaagagaaagagggtgagagctcgggtagccaggaagac
cagctgtgtacagctctcgtgaaccagctgaacagatttgcagacaaggagactctgatc
cagtttctgcgctgcttcctattggagtccaactcttcgtcagtacgctggcaggcccac
tgcctgacactgcacatctacagaaactccaacaaggctcagcaggagctcttgctagat
ctcatgtggtcaatctggccagaactcccagcttatggtcggaaggctgcccagtttgtg
gatctcctgggctatttctccctgaaaactgcacagacagagaagaagttgaaggagtac
tcacagaaggccgtggagattctgaggactcagaaccacattctcaccaatcatcccaac
tccaacatttacaataccttgtctggcttagtggagtttgatggctactacctagagagt
gatccctgcctggtgtgtaataaccctgaagtgccgttttgttatatcaagctgtcttcc
attaaagtggacacacggtacaccaccacccagcaggtggtaaagctcattggtagtcac
accatcagcaaggtgacagtgaaaattggggacctgaagcggaccaagatggtgcggaca
atcaacctgtattacaacaaccgaactgtgcaggccattgtggagttgaaaaataagcca
gctcgctggcacaaagccaagaaagttcagctgacgcctggacagacagaagtcaagatt
gacctgcctctgcccattgtggcctctaacctgatgatcgagtttgcagacttctatgag
aactaccaggcttccacagagacccttcagtgtcctcgctgcagtgcctctgtccccgcc
aatcccggcgtctgtggcaactgtggcgagaatgtataccagtgtcacaagtgcaggtcc
atcaactatgatgagaaggatcccttcctctgcaatgcttgtggcttttgtaaatatgcc
cgctttgacttcatgctttatgccaaaccttgctgcgcagtggatcccatcgagaacgag
gaagatcggaagaaggccgtttccaacatcaacacacttctggacaaagctgaccgcgtg
taccatcagctcatgggacaccggccccagctggagaacctgctctgcaaagtgaatgaa
gcagctccagaaaagccacaggaagactcgggaacagcgggaggcatcagctccacttca
gccagtgtgaatcgctacatcctacagctggcgcaggagtattgtggagactgtaagaac
tcatttgacgagctctccaaaatcatccagaaagtcttcgcttcgcgcaaagagctgtta
gagtatgacctgcagcagagagaagcggccaccaagtcatcccggacatccgtgcagccc
acgtttactgccagccagtaccgtgcgttgtctgtcttaggctgtggccacacctcctcc
accaagtgctatggctgtgcctcagctgtcacagagcattgtatcacactgctaagggcc
ctggccaccaatccagccctgagacacatcctcgtctcccagggcctcatccgagagctc
tttgattacaacctccgcagaggcgcggcagccatccgcgaggaggtccgccagctcatg
tgcctcctgactagagacaacccagaggccacccagcaaatgaatgacctgatcattggc
aaagtctccactgcactgaagggccactgggctaatcctgacctggctagcagccttcag
tatgagatgctgctgctgacagactccatctccaaggaggacagctgctgggaactccgc
ttacgctgtgcactcagccttttcctcatggctgtgaacatcaaaacgccagtggttgtt
gagaacatcaccctcatgtgtctgcggatcttacagaagctgattaaaccacctgcccca
accagcaagaagaacaaggacgtccctgtggaggccctcaccacggtgaagccgtactgc
aatgagatccacgcgcaggctcagctgtggctcaagcgagatcctaaggcatcctacgaa
gcctggaagaagtgcctgcctatccgaggggtagatggcaacgggaaatcccccagcaag
tccgagctccaccggctctacttgactgagaagtatgtgtggaggtggaaacagttcctg
agtcggcgggggaagaggaccaccccacttgacctcaagctgggccacaacaactggctg
cggcaggtactctttaccccggcaacacaggcagcacggcaggcagcctgtactattgtg
gaagctcttgcttctgtccccagccgcaagcagcaggtccttgacctcctcaccagttac
ctggacgagctgagtgtggctggggagtgtgctgcagagtacctggctctctaccagaag
ctcatcgcctcctgccactggaaagtctacctggctgctcggggagtcctgccctacgtg
ggcaacctcatcaccaaggaaatcgcccgcctgctggccttggaggaggccacactgagc
acagacctgcagcagggatatgccctcaagagtctcacaggcctcctctcctcctttgta
gaggtggagtccatcaagcgtcatttcaagagccgcttggtgggcactgtgctgaatggg
tacctgtgcttgcggaaactagtgctgcagaggaccaagctcatcgatgagacccaggac
atgctgctggagatgctggaggacatgaccacaggtacagagtctgaaaccaaggccttc
atggctgtgtgcattgagacagccaagcgctacaatctggatgactaccggactcctgtg
ttcatctttgagaggctgtgcagcatcatctaccctgaggaaaatgaagtcactgagttc
tttgtgaccctggagaaggacccccagcaagaggactttctacagggcaggatgcccgga
aacccatatagcagcaatgaaccaggcattgggcctcttatgagggacataaagaacaag
atctgccaggactgtgacctggtggctcttctggaggacgacagtgggatggagcttcta
gtgaacaataaaattatcagtctggatcttcctgtggctgaggtttacaagaaggtctgg
tgtacgaccaatgagggagagcccatgaggattgtttatcgaatgcgggggctactgggc
gatgccaccgaggagtttatcgagtccctggactccaccacagatgaagaagaggacgaa
gaggaagtgtacagaatggccggtgtgatggcccagtgcgggggtctgcagtgcatgctg
aacagactggcaggagtcaaagattttaagcaggggcgccaccttctaacagtgctcctg
aagctgttcagttactgtgtgaaggtgaaagtcaatcggcaacagttggtcaagctggaa
atgaacaccttgaatgtcatgttggggactttaaacttggctctggtagctgagcaagag
agcaaggacagcggaggagcagcggtggctgagcaggtgctgagcatcatggagatcatt
ctagatgagtccaatgcagagcccctgagtgaggacaagggcaacctcctcctcacaggt
gacaaggatcaactggtgatgctcttggaccagatcaacagcaccttcgttcgttccaat
cccagcgtgctgcagggtttgctgcgtatcatcccatacctgtccttcggagaggtggag
aagatgcagatcctggtggagcggttcaagccatactgcagcttcgataagtacgatgaa
gaccatagtggggatgacaaagtcttcctggattgcttctgcaagattgctgctggtatc
aagaacaacagcaatggtcatcagctgaaggacctcatcctgcagaagggaatcacccag
agtgccctggactacatgaaaaagcatatccccagtgccaagaatttggatgctgacatc
tggaaaaagtttttgtctcggcctgctctgccatttattttgaggcttcttcggggtctg
gccatgcaacaccctgccacccaggttctgattggaacggactccatcacaagcctgcat
aagctagagcaggtgtccagtgatgagggcattgggaccttggccgagaacctcctggag
gccctaagagaacacccagatgtgaacaagaagattgacgcagcccgcagagagacccgg
gcagagaagaagcgcatggccatggccatgaggcagaaggctctgggaactctgggcatg
acgacaaacgagaagggtcaggtggtgaccaagactgcgctcctgaagcaaatggaagag
ctgattgaggagcccggactcacgtgctgcatctgcagggaggggtacaagttccagccc
acgaaggtcttaggcatttacactttcaccaagcgggtggccttggaggagatggagaac
aagcctcggaaacagcagggctacagcactgtgtcccatttcaacatcgtgcactatgac
tgtcacctggctgctgtcaggttggctagaggccgggaagagtgggaaagtgctgccctg
cagaacgccaacacgaagtgcaatggactccttccggtctggggcccccatgtccctgag
tcagcttttgccacttgtttagctaggcacaacacttacctccaggagtgtaccggccag
cgggagcccacgtaccagctcaacatccacgacatcaaactgcttttcctgcgcttcgcc
atggagcagtcattcagtgcagacaccggtgggggcggtcgggagagcaacatccacctg
atcccgtacatcattcacactgtgctttacgtcctgaacacgacccgagcaacgtcccgg
gaggagaagaacctccaaggcttcctggagcagcccagagagaagtggacagagagtgcc
tttgatgtagatgggccccactacttcaccatcttagccctgcatgtcctcccccctgag
cagtggaaagccactcgagtggagatcctacgcaggctgctggtggcctcgcatgcccgg
gcagtggctccaggaggagccaccaggttgacagataaggcggtgaaagactattctgcc
taccgttcttccttgctgttctgggctctcgttgatctcatttataacatgtttaagaag
gtgcccactagtaacactgagggcggctggtcctgctctctggctgagtacatccgccac
aatgacatgcccatctacgaagctgccgacaaagccctgaaaaccttccaggaggagttc
atgccagtggagaccttctcagagttcctcgacgcagcaggtcttctatcagaaatcacc
gacccagagagcttcctaaaggacctgttgaactcagtcccctga

DBGET integrated database retrieval system