KEGG   Rattus norvegicus (rat): 313666
Entry
313666            CDS       T01003                                 

Gene name
Zbtb17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    313666 (Zbtb17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    313666 (Zbtb17)
   05202 Transcriptional misregulation in cancer
    313666 (Zbtb17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    313666 (Zbtb17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    313666 (Zbtb17)
   04121 Ubiquitin system [BR:rno04121]
    313666 (Zbtb17)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    313666 (Zbtb17)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     313666 (Zbtb17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf-BED zf-C2HC_2 zinc_ribbon_15 zf-C2HE zf_UBZ Packaging_FI HypA XPA_N
Other DBs
NCBI-GeneID: 313666
NCBI-ProteinID: NP_001012105
RGD: 1307143
Ensembl: ENSRNOG00000010436
Vega: OTTRNOG00000001156
UniProt: Q5XIU3
Position
5
AA seq 801 aa
MDFPQHSQRVLEQLNQQRQMGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLHLSPENVDDVLAVASFLQMQDIITACHTLKSLAEPTST
TGESADASAEEVCCVLSPGGDKRAKEEKAAATVLSRLDQARSSSSAGPGRELKEEWGGQA
ESASRGAEQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEMEVEPASKGEEGQ
EEEGPGPATVKEEGVHLENGEPPEENEESAGTDSGHELGMEGQNLRSGTYGDRTESKAYG
SIIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPY
GCEECGKSYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRHQLVHSGQKPYQCDY
CGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQ
FTTSGNLKRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTGEKPCQCVICGKAFTQA
SSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLS
KHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDM
VTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSC
GDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGAWPAGQMLQAGELVFRPRDGT
EGQPTLAETPPTAPDCLPPAE
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggacttcccccagcacagccagcgtgtcttggagcagctgaaccagcagcggcaaatg
ggcctcctctgtgactgcacctttgtggtggacggcgttgacttcaaagctcacaaggcg
gtgctggcagcctgcagcgagtacttcaagatgctctttgtggaccagaaggatgtggtg
cacctggacatcagtaatgcggcaggcctggggcaggtgctggagttcatgtacactgct
aaactgcaccttagccctgagaacgtggatgatgttctggctgtggccagcttcctccag
atgcaggacattatcacagcctgccacaccctgaagtccctcgctgagcccaccagcacc
actggggagagtgcagacgcctcggccgaggaagtctgttgtgttctgtctccaggagga
gacaagcgagccaaagaagagaaggctgccgccaccgtgctgagcaggctggaccaagca
agaagcagttcatccgcaggcccaggcagagagctcaaagaggagtggggtggtcaggca
gagagtgcatccaggggcgcagaacagacggagaaggccgacgcgccccgggagcctcca
cctgtggagctcaagccggaccccacgagcagcatggctgctgcagaagcggaagcctta
tcagagagctcagagcaagaaatggaagtggaaccagccagcaaaggagaagagggccaa
gaggaagagggcccagggcctgccacggtcaaggaagagggcgttcacctggagaacggg
gagcctcctgaggagaatgaagagtctgcgggcacagactctgggcacgagcttggcatg
gagggccagaacctgcgctcgggcacctacggggaccgcactgagtccaaggcttatggc
tccatcatccacaagtgcgaggactgcgggaaggagttcacgcacacagggaacttcaaa
cggcacatccgcatccacacgggtgagaagccattctcctgtcgggagtgcagcaaggct
ttctcggaccccgcagcctgcaaggctcacgagaagacacacagcccgttgaaaccctat
gggtgcgaggagtgcggcaagagctacaggctcatcagcctgctgaacctgcacaagaag
aggcactcgggggaggcgcgctaccgctgcggggactgcggcaagctcttcaccacttcc
ggcaacctcaagcgccaccagctggtacacagtggccagaaaccctaccagtgcgactac
tgtggccgttcattctccgaccccacgtccaagatgcgccacctggagacccatgacact
gacaaggagcacaagtgccctcactgtgacaagaagttcaaccaggtggggaacctgaag
gcccacttgaagatccacattgctgacggccctctcaagtgccgggagtgcgggaagcaa
ttcaccacctcagggaacctcaagcggcacctgcggatccacagcggggagaagccgtat
gtatgcacccactgtcagcggcagtttgctgacccaggcgcgctgcagcggcacgtacgg
atccacacgggtgagaagccgtgtcagtgcgtgatatgtggcaaggccttcacccaagcc
agctccctcatcgcccacgtacgccagcacacgggggagaagccctatgtctgtgaacgc
tgtggcaagagatttgtccagtcaagccagttggccaatcacattcgtcaccatgacaac
atccgcccacacaagtgcagcgtgtgtagcaaggccttcgtgaatgtgggggacctgtcc
aagcacattatcatccacactggagagaagccttacttatgtgacaagtgtggccgtggt
ttcaaccgggtagacaacctgcgttctcacgtaaagaccgtgcatcagggcaaggcgggc
atcaagatcctggagccagaagagggtggtgaggtcagcgtggtcactgtggacgacatg
gtcacactggccactgaggcactggcagcgacagcggtcactcagctcacagtggtacca
gtcggggccgcagtgacagctgatgagacggaggttctcaaagctgagatcagcaaagct
gtcaagcaagtgcaggaagaagatcccaacacccacatcctgtatgcgtgtgattcctgt
ggggacaagttcctggatgccaatagcctggcccagcacgttcggatccacacagcacag
gcactggtcatgttccagacggatgcggacttctaccagcagtacgggccaggtggcgcg
tggccagccgggcagatgctgcaggctggagagctggtcttccgtcctagggatgggact
gagggccagcccacactggcagaaactccacccacagctcctgattgcctaccacctgcc
gagtaa

DBGET integrated database retrieval system