KEGG   Rattus norvegicus (rat): 314384
Entry
314384            CDS       T01003                                 

Gene name
Rps6ka5
Definition
(RefSeq) ribosomal protein S6 kinase alpha-5
  KO
K04445  ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04713  Circadian entrainment
rno04722  Neurotrophin signaling pathway
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    314384 (Rps6ka5)
   04668 TNF signaling pathway
    314384 (Rps6ka5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    314384 (Rps6ka5)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    314384 (Rps6ka5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    314384 (Rps6ka5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    314384 (Rps6ka5)
   05206 MicroRNAs in cancer
    314384 (Rps6ka5)
  09162 Cancer: specific types
   05219 Bladder cancer
    314384 (Rps6ka5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    314384 (Rps6ka5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     314384 (Rps6ka5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   314384 (Rps6ka5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C ABC1 Kdo Pkinase_fungal Kinase-like APH Haspin_kinase
Other DBs
NCBI-GeneID: 314384
NCBI-ProteinID: NP_001101518
RGD: 1308336
Ensembl: ENSRNOG00000004362
UniProt: D3ZY17
Position
6
AA seq 518 aa
MEGEGGGSGGAGTSGDSGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYG
KVFLVRKISGHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAF
QTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKLE
NILLDSNGHVVLTDFGLSKEFVADEAERAYSFCGTIEYMAPDIVRGGDSGHDKGMSSVAK
DLLQRLLMKDPKKRLGCGPRDAEEIKEHLFFEKINWDDLAAKKVPAPFKPVIRDELDVSN
FAEEFTEMDPTYSPAALPQSSERLFQGYSFVAPSILFKRNAAVIDPLQFHMGVDRPGVTN
VARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKTNQAFAVKIISKRMEANTQK
EITALKLCEGHPNVVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRK
LVSAVSHMHDVGVVHRDLKPETVFHREISRSPVISMRI
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggagggggagggcggcggcagcggcggcgcgggcaccagcggggacagtggcgacggc
ggcgagcagctccttactgtcaagcatgagctgcggaccgccaacttaacaggacatgca
gagaaggtgggaattgaaaattttgagctgctgaaggtcctaggaactggagcttatggg
aaagtatttctagttcgtaaaataagcggccatgatgctggaaagctgtatgccatgaaa
gttttaaaaaaagcaacaatcgttcagaaggctaaaactacggagcatacgaggacagaa
cggcaggttctggagcacattagacagtcgccatttctggtgacgttgcactatgctttc
cagacagagaccaagcttcatctcatcttagattatataaatggtggagaactttttact
catctttctcaaagagagcgtttcacagagcacgaagtgcagatctatgttggagagatc
gtgcttgccctggaacacctgcacaagttggggattatataccgtgacattaagctggaa
aatattctacttgattctaatggccatgtggtgctgacagattttggtctgagtaaggag
tttgtggctgatgaagccgaaagagcgtattctttctgtgggactattgagtacatggcg
ccagatattgtcagagggggcgattccggacatgacaagggaatgagctcagtagctaaa
gacctccttcagcgtcttttgatgaaagatcccaagaagcgattgggatgtggcccacgg
gatgcagaagaaatcaaagaacatctcttctttgagaagataaattgggatgacttagct
gccaaaaaagtgcctgcgccctttaaaccagtgatccgggacgagttagacgtgagtaac
tttgctgaagagttcacagagatggaccccacctactctcctgcagctctgccccagagc
tctgagcgactgttccagggctactccttcgttgctccttccatcctcttcaagcgtaac
gcggcggtcatagatccccttcagttccatatgggagtagaccgccctggagtgacaaac
gttgccaggagcgcaatgatgaaggactcaccattctaccaacactatgacctagatctg
aaggacaaacctttgggagaaggaagtttttcaatctgtcggaagtgtgtacacaaaaaa
actaaccaagcctttgccgtcaaaataatcagcaaaaggatggaagccaatactcagaaa
gaaataacagctctgaaactctgcgaaggccaccccaatgttgtgaagctgcatgaagtt
tttcatgaccagcttcatacatttcttgtgatggagcttctgaatgggggagagctgttt
gagcgcatcaagaaaaagaagcacttcagcgagactgaggccagctacattatgcggaag
cttgtgtcggctgtgagccacatgcacgatgttggagtggtgcacagagacctgaagccg
gagacagtgttccatagagagatcagcagatctcccgtcatttccatgagaatctaa

DBGET integrated database retrieval system