KEGG   Rattus norvegicus (rat): 314949
Entry
314949            CDS       T01003                                 

Gene name
Rad21
Definition
(RefSeq) double-strand-break repair protein rad21 homolog
  KO
K06670  cohesin complex subunit SCC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    314949 (Rad21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    314949 (Rad21)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    314949 (Rad21)
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8 SMC_ScpA
Other DBs
NCBI-GeneID: 314949
NCBI-ProteinID: NP_001020872
RGD: 1594529
Ensembl: ENSRNOG00000004420
UniProt: Q4KLH7
Position
7
AA seq 635 aa
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSETGVMLPEQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREEQQPQPQQQQAQRDVIDEPIIEEPSRLQDSVMEASRTNIEESAMPPPPPQGV
KRKAGQVDPEPAIPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEEE
EEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAK
FYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgttctacgcacattttgtcctcagcaaacgagggcctctggccaaaatttggctggcg
gcccattgggacaagaagctaaccaaagcccatgtgtttgagtgtaacttagaaagcagt
gtggaaagtatcatctcacctaaggtgaagatggcgctgcggacgtcaggacacctcctc
ctgggcgtagtccgcatctatcacaggaaagccaaatacctcctcgcggactgtaatgaa
gcatttattaaaataaagatggcttttcggccaggtgttgtcgatctacctgaggaaaat
cgggaagcggcttataatgccattactttacctgaggaatttcacgattttgaccagcca
ctgccagacttagatgacattgacgtcgcccagcagttcagcttgaaccagagcagagta
gaagagataaccatgagagaagaagttgggaacatcagtatcctacaggaaaatgacttc
ggtgactttggaatggatgaccgtgaaatcatgagagaaggcagtgctttcgaggatgac
gacatgttagtgagcaccagtgcttccaacctcctcctagagcctgagcagagcaccagc
aacctgaatgaaaagattaaccatttagagtatgaggaccagtacaaagatgataacttt
ggagaaggcaatgatggtggtatattggacgacaaacttataagtaataatgacggtggc
atctttgacgacccccctgccttgtctgagacgggggtcatgttgccagagcagcctgca
cacgatgatatggatgaggatgacaatggctcgttgggtgggcctgatagtcctgactct
gtggatcctgttgaaccaatgccaaccatgactgatcagacaacactcgtcccaaatgag
gaagaagcttttgcattggagcccattgatataactgtcaaagaaacaaaagccaagagg
aagaggaagctgattgttgacagtgtcaaggaattggatagtaagacaattagagcccaa
ctcagtgattactctgatattgttacaactctggacctggccccgcccaccaagaagctg
atgatgtggaaagagacgggaggggtggagaagctcttctccttaccagcgcagccattg
tggaataaccgactactgaagctctttacacgctgccttactccacttgtaccagaagac
cttaggaaaagaaggaaagggggagaggcagataatctggatgagttcctcaaagagttc
gagaacccagaggtcccccgagaggagcagcagccgcagccacagcagcagcaggcgcag
cgtgacgtcattgatgagcccattatagaagagccaagccgccttcaggactcagtgatg
gaggccagcagaacaaacatagaagagtcggccatgcctccaccaccccctcagggagtt
aagcgaaaagccgggcaagtagacccggagcctgcgattcctcctcagcaggtagagcaa
atggaaataccaccagtagaacttcccccagaagaacctcccaatatctgtcagctgata
ccggagttagagcttctaccagaaaaggagaaggagaaagagaaggagaaggaggaggaa
gaagaggaggaggatgaagatgcttcagggggtgatcaggatcaagaggaaaggagatgg
aacaaaaggactcagcagatgcttcatggtcttcagcgagctcttgctaaaactggagca
gagtcgatcagtttgcttgagctatgtcgaaacacaaaccgaaagcaggcagcagcaaag
ttctacagctttttggttcttaaaaagcagcaagccatcgagctcacacaggaagagccg
tacagtgacatcattgcaacacctggaccaaggttccacatcatctga

DBGET integrated database retrieval system