KEGG   Rattus norvegicus (rat): 315599
Entry
315599            CDS       T01003                                 

Gene name
Nlrx1
Definition
(RefSeq) NLR family member X1 precursor
  KO
K12653  NLR family member X1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    315599 (Nlrx1)
   04622 RIG-I-like receptor signaling pathway
    315599 (Nlrx1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    315599 (Nlrx1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    315599 (Nlrx1)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   315599 (Nlrx1)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 NOD2_WH AAA_16 DUF815 TsaE AAA_22 AAA_25
Other DBs
NCBI-GeneID: 315599
NCBI-ProteinID: NP_001020181
RGD: 1311293
UniProt: Q5FVQ8
Position
8
AA seq 973 aa
MRWGCHLPRTSWGSGLGRTVPLPDELRIQSSWPFKGVHHPLRPPRAFIRHHGNSADSAPP
PGRHGQLFRSISATEAIQRHRRNLTEWFSRLPREERQFGPTFALDTVHVDPVIRESTPDD
LLRPSTELATGHQRTQAELPPLALSQLFDPDACGRRVQTVVLYGTVGTGKSTLVRKMVLD
WCYGRLPAFELLIPFSCEDLSSLGSTPASLCQLVTQRYTPLKEVLPLMNAAGSRLLFVLH
GLERLNLDFRLAGTGLCSDPEEPGAPAAIMVNLLRKYMLPEASILVTTRPSAIGRIPSKY
VGRYGEICGFSDTNLQKLYFQLRLNQPDCGYGAGGTGVSVTPAQRDNLIQMLSRNLEGHH
QIAAACFLPSYCWLVCATLHFLHAPTSAGQTLTSIYTSFLRLNFNGETLDSTDPSNLSLM
SYAARTMGKLAYEGVSSRKTYFSEEDVRGCLEAGIKTEEEFQLLQIFRRDALRFFLAPCV
EPGHLGTFVFTVPAMQEYLAALYIVLGLRKTALQRVGKEVFEFVGRVGEDVSLVLGIVAK
LLPLRILPLLFNLLKVVPRVFGRMVSKSREAVAQAMVLEMFREEDYYNDDVLDQMGASIL
GVEGPRRHPDEPPEDEVFELFPMFMSGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKL
GKMGRQVLPPSELLDHLFFHYEFQNQRFSAEVLGSLRQLNLAGVRMTPLKCTVVASVLGS
GRHPLDEVNLASCQLDPAGLHTLMPVLLRARKLGLQLNNLGPEACRDLRDLLLHDQCQIT
TLRLSNNPLTAAGVGVLMDGLAGNTSVTHLSLLHTDLGDEGLELLAAQLDRNKQLQELNV
AYNGAGDTVALALAKAARKHPSLELLHLYFNELSSEGRQVLRDLGGSGEGGARVVASLTE
GTAVSEYWSVILSEVQRNLNSWDPVRVQRHLKLLLRDLEDSRGATLNPWRKAQLLRVESE
VKTLLEQLGGSGH
NT seq 2922 nt   +upstreamnt  +downstreamnt
atgaggtggggctgccatttgcccaggacctcttggggctctggcctgggaagaacagtc
ccgctcccagacgagctccggattcagtcgagctggccctttaaaggggtgcatcatccc
cttaggccccctagggcctttatccgtcaccatggaaactcggcagacagtgctccccca
ccagggaggcatgggcagctgttcaggagcatctctgccactgaagctatccaaaggcat
cgtcggaacctcactgagtggtttagccggctgcccagagaggagcgccagtttggacca
acctttgctctagacacagttcacgttgaccccgtgatccgagagagcaccccagatgac
ctgcttcgtccatccacggagctggccacagggcatcagcgaacccaggcagagctcccc
ccactggccctgtctcagctctttgacccagatgcctgtgggcgccgcgtgcagacagtg
gtattgtatgggaccgtgggtactggcaagagcacattggtgcgcaagatggtcttagac
tggtgttatgggagactgcctgcctttgagctgctcatccccttctcctgtgaggacctg
tcatccctgggctccaccccagcttccttatgccaacttgtgacccagcgttacacaccc
ctgaaagaggtgttgcccctgatgaatgctgctggatcccgcctgctctttgtgctccat
ggcttggaacgcctcaaccttgacttccggctggcaggcacagggctttgcagtgacccg
gaggaacccggggcaccagctgccatcatggtcaacctgctgcgcaaatacatgcttcct
gaggccagcattctggtaaccacccggccctccgccattggccgtatccctagcaagtac
gtgggccgctatggtgaaatctgtggcttctcggataccaacctgcagaagctctacttc
cagctccgccttaaccagcctgactgtgggtatggtgctgggggtacaggtgtctcagtt
acaccagctcagcgggacaatctcattcaaatgctgtcccgaaacctggaggggcaccac
cagatcgcagccgcctgctttctgccctcctactgctggcttgtctgtgctaccttgcac
ttcctgcatgctcccacatctgctggtcagactctcacaagcatctataccagctttcta
cgtctgaacttcaatggggaaacactggacagcaccgacccctccaacttatccctgatg
tcctatgcagcccggactatgggtaagttggcctatgagggggtgtcatcccgaaagacc
tacttctctgaagaggatgtccgtggctgcctggaagctggcatcaagacagaggaggag
tttcagctgctccagatcttccgccgggatgccctgaggtttttcctggccccgtgtgtg
gaaccagggcacctgggtaccttcgtattcaccgtacctgccatgcaggagtatctggct
gccctctacatcgtgcttggtttgcgcaagacagccctgcagcgggtgggcaaagaagtg
tttgaatttgtgggccgtgttggggaagatgtcagcctggtattgggcattgtggccaaa
ctgttgcccctgcggattctgcctctgctattcaacttgcttaaggtggttccacgagtg
tttgggcgcatggtgagtaagagtcgcgaggcggtggctcaggccatggtgctggagatg
ttccgggaggaagactattacaatgacgatgttctggatcagatgggtgccagcatcctg
ggtgtggagggcccccggcgccacccagatgaaccccctgaggatgaagtctttgagctc
ttccccatgttcatgagtggacttctctctgcccacaatcgggcggtgttggctcagctt
ggctgtcccattaagaacctggatgccctggagaatgcccaggcaatcaagaagaaactg
gggaagatgggtcggcaggtgctgcccccctcggagcttcttgaccatctcttctttcac
tatgagttccagaaccagcgcttctcagctgaggtgctgggctccctacgacagctcaat
ttagcaggtgtgcgaatgacacccctcaagtgcacggtggtagcgtctgtactgggaagt
ggacggcaccccctggatgaagtgaacttggcctcctgccagctggaccccgctgggcta
cacactctcatgcctgttctcctgcgggcccggaaactggggttgcaactcaacaatctg
ggccctgaggcctgcagagacctccgagacctgctgttacatgaccaatgccagatcacc
actctccggctgtccaacaacccactgacagcagcaggggtgggtgtgctgatggacggg
ctggcaggaaacacttcggtgacacacctgtccctgctgcacactgaccttggagatgag
ggactggagttgctggctgcccagctggaccgtaacaaacaactacaggaactgaatgtg
gcctacaatggtgctggggacacggtggctctggccttggctaaggctgctcggaagcac
ccgtccctggagctgctgcacctctacttcaatgagctgagttcagagggtcgccaggtc
ctgcgggatttgggcggctctggcgaaggtggtgcccgggttgtagcctcgctgacagag
gggacagcggtgtctgagtactggtcagtgatcctcagtgaagtccaacgcaacctcaac
agctgggaccctgtccgggtccagcgccatctcaagctgctgctccgagacttggaagac
agcagaggtgccacccttaatccttggcgcaaggctcagcttctgcgggtggagagcgag
gtcaagactcttctggagcagctgggaggctctggacactga

DBGET integrated database retrieval system