KEGG   Rattus norvegicus (rat): 315852
Entry
315852            CDS       T01003                                 

Symbol
Ttk
Name
(RefSeq) dual specificity protein kinase TTK
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    315852 (Ttk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    315852 (Ttk)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    315852 (Ttk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     315852 (Ttk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  TTK family
   315852 (Ttk)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     315852 (Ttk)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo ABC1 Pkinase_fungal RIO1 TCAD9 FTA2 Mad3_BUB1_I APH Mad3_BUB1_I_2 Tubulin
Other DBs
NCBI-GeneID: 315852
NCBI-ProteinID: NP_001101642
RGD: 1305558
Ensembl: ENSRNOG00000029055
UniProt: D4A4S7
Position
8
AA seq 835 aa
MEAEELIGRNLTIDSIMNKVRDIKNKINEDLTDELNSIKVCVDPTETVNQIMMVENTPEN
WLNFLLKLEKNSPPLNDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRLAELKAIQE
PDDAHDYFQMARENCKKFAFVHVSFAQFELSQGNLKKSEQLLHKAVETGAVPLQMLETAI
RNLHLQKKQLLSEEDKKSLSASTVLTAQESFSSSLGNLQSRKSSCDPKVQAAAARILYGE
NMPPKDAEVSHRNPLKQTNKTKRSCPFGRVPVNLLNSPDYYVKTDGSAVPQFTKRKISGS
EYRDSIMPGSKSSGNDSYELRGLKPIQAIHLKDSLVSNEKSSELMSDLVTLKSKTDSSLT
KLEEPKVRQEPEIPERRHKQWQSARKPGCGIQNSAAFAPQWHVPDVTPKADKESPPLSVP
KWIDPKSVCETPSSSSLDDYMKCFKTSVVKNEFPPACPSSTPYSQLARHQQHQQQGLSTP
LQNLQISGSSSMSECISVNGRIYSILKQIGSGGSSKVFQVLNEKKQINAIKYVNLEDADS
QTIDSYRNEIAYLNKLQQHSDKIIRLYDYEITDRYIYMVMECGNIDLNSWLKKKKSINPW
ERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSIVKDS
QVGTVNYMAPEAIRDMSSSRENGKIKTKISPRSDVWSLGCILYYMTYGKTPFQHIINQVS
KLHAIIDPSHEIEFPEISEKDLRDVLKCCLVRNPKERISIPELLAHPYVQIQPHPGSQMA
KETTDEMKYMLGQLVCLNSPNSILKAAKTLYERYNCGESQAPSSSKTSDKKRERE
NT seq 2508 nt   +upstreamnt  +downstreamnt
atggaggctgaagagttaattggcagaaatttgacaattgattccatcatgaacaaagtg
agagacattaaaaataagataaatgaagaccttactgatgagctaaactcgatcaaagtc
tgtgttgaccccacagaaactgttaaccaaattatgatggttgagaacacaccagagaac
tggttgaatttcttgctgaaactagagaaaaacagcccacctctaaacgatgctctttta
aataagctgattggtcggtatagtcaagccattgaagcacttcctccagataaatatggc
cagaatgagagctttgctcgaatacaagtgagacttgcagaattaaaggctattcaagaa
cctgacgatgctcacgactacttccaaatggcccgagagaactgcaagaagtttgctttc
gtgcatgtctctttcgcacagtttgaactgtctcaaggcaatcttaagaaaagcgaacag
cttcttcataaagctgtagagacgggggcagtgccgctgcagatgctggagactgccatc
cgtaacctacacctccagaaaaagcagctgctctcagaggaggacaaaaagagtttatca
gcatctacagtactaactgcccaagaatcattctccagttcacttgggaatttacagagt
aggaagagcagctgcgatcccaaagtacaggctgctgcagccaggattttatatggggag
aacatgcctccaaaagatgcggaagtaagtcatcgaaatcccttaaagcaaactaacaaa
actaaacggtcatgcccctttggaagagtcccagttaatcttctaaatagcccagattac
tatgtgaagacagatggttcagctgtgccacagtttacaaaaagaaaaatatctggatca
gaataccgagattcgattatgcctggatccaaatcaagtggaaatgattcctatgaattg
agaggtttaaagcccattcaagctatccatttgaaagactctctggtgtccaatgaaaaa
agttctgaacttatgtctgatttagtaaccttgaagagtaaaacggattcaagtctaaca
aagttggaagaacctaaagtgcgtcaagaaccggagattccagaaagaaggcacaagcag
tggcagtctgccagaaagccaggctgtgggatccagaactcggctgcctttgccccccag
tggcacgttccagatgtaaccccaaaggctgataaagagtcaccaccattatcagttcct
aaatggattgatccaaagtctgtctgtgagacacctagtagcagttccttggatgattac
atgaaatgttttaagacttcagttgtaaagaatgaattcccacctgcctgtccatcatca
acaccttacagccaacttgcccgccaccagcagcatcagcagcaagggctcagcactcct
cttcaaaacttacagatttcaggatcctcatcaatgagtgaatgcatttcagttaacgga
agaatttattccatattaaaacagataggcagtggaggttcaagtaaggtgtttcaggta
ttgaatgagaagaaacagataaacgctatcaaatacgtgaaccttgaagacgcagatagc
caaactattgacagctaccgcaatgagatagcttacttgaacaagttacagcagcacagt
gataagatcatccgcctctatgactatgaaatcacggatcggtacatctacatggtgatg
gaatgtggaaacattgacctgaacagttggcttaaaaagaagaaatccatcaatccatgg
gaacgcaagagctactggaaaaacatgttggaggccgtacacacgatccatcaacatggc
attgttcatagtgatctcaagcctgctaactttctaatagttgacggaatgctaaagcta
attgattttgggattgcaaaccaaatgcagccagatacaacaagcattgttaaagattct
caggttggcacagtaaactacatggccccagaagcaatcagagacatgtcttcttcaaga
gaaaatgggaaaatcaagaccaagataagtcccagaagtgatgtgtggtccttggggtgc
attttgtactatatgacctacgggaaaacaccatttcagcatatcattaatcaggtctct
aaactacatgccataattgaccctagtcatgaaattgagtttcctgagatttcagaaaaa
gatcttcgagatgtgctaaagtgctgcctagtacggaaccctaaagagaggatatctatc
cccgagctcctcgcacatccatatgttcagattcagccccatccaggcagccaaatggct
aaggagaccactgatgagatgaaatatatgttgggtcaacttgtttgcctgaattctcct
aactccatcctgaaagctgcgaaaaccttgtatgaacgttataattgtggtgaaagtcaa
gctccttcatcatccaagacttctgacaaaaagagagaaagagagtga

DBGET integrated database retrieval system