KEGG   Rattus norvegicus (rat): 316010
Entry
316010            CDS       T01003                                 

Gene name
Camp
Definition
(RefSeq) cathelicidin antimicrobial peptide precursor
  KO
K13916  cathelicidin antimicrobial peptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04970  Salivary secretion
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    316010 (Camp)
   04621 NOD-like receptor signaling pathway
    316010 (Camp)
  09154 Digestive system
   04970 Salivary secretion
    316010 (Camp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    316010 (Camp)
   05152 Tuberculosis
    316010 (Camp)
SSDB
Motif
Pfam: Cathelicidins CAP18_C Cystatin Spp-24
Other DBs
NCBI-GeneID: 316010
NCBI-ProteinID: NP_001094194
RGD: 1559878
Ensembl: ENSRNOG00000020733
UniProt: G3V8S9
Position
8
AA seq 175 aa
MQPHRDVPSLWRSLSLLLLLGLGLPLAVSQTLSYREAVLRAVDDFNQQSLDTNLYRLLDL
DSEPQGDEDPDTPKYVRFRVKETVCSKASQQLPEQCAFKEQGVVKQCMGTVTLNQAAESF
DISCDAPGIQPFRFKKISRLAGLLRKGGEKFGEKLRKIGQKIKDFFQKLAPEIEQ
NT seq 528 nt   +upstreamnt  +downstreamnt
atgcaaccccatagggacgtcccttccctgtggcgctcactgtcactgctattgctcctg
ggccttgggttgcctctagccgtttcccagaccctcagctacagggaggctgtactccgt
gctgtggatgacttcaaccagcagtctttggacaccaatctctaccgtctcctggacctg
gattctgagccccaaggggatgaggacccagatactcccaagtatgtgaggttccgagtg
aaggagactgtctgtagcaaggcatcacagcagttacctgagcaatgtgccttcaaggaa
cagggggtagtgaagcagtgtatggggacagtcaccctgaaccaggctgcagagtctttt
gacatcagttgtgatgcgcctggtatacagcctttccggttcaagaaaatttcccggctg
gctggactcctccgaaaaggtggagagaagtttggtgaaaagcttaggaaaatcggccag
aaaattaaggattttttccagaaacttgcacctgaaatagagcagtag

DBGET integrated database retrieval system