KEGG   Rattus norvegicus (rat): 316051
Entry
316051            CDS       T01003                                 

Gene name
Azi2
Definition
(RefSeq) 5-azacytidine-induced protein 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    316051 (Azi2)
SSDB
Motif
Pfam: TBD Prefoldin_2 bZIP_2 CCDC92 Spc24
Other DBs
NCBI-GeneID: 316051
NCBI-ProteinID: NP_001020876
RGD: 1310530
Ensembl: ENSRNOG00000010096
UniProt: Q4KMA0
Position
8
AA seq 404 aa
MDTLVEDDICILNHEKAHKREAVTPLSAYPGDESVASHFALVTAYEDIKKRLKDSEKENS
FLKKRIRALEEKLVGARVEEETSSVGREQVNKAYHAYREVCIDRDNLKSRLEKISKDNSE
SLRALTEQLQCKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELL
RKECSDLRTELQKARQTGPSQEDILQDRDVIRPSLPREEHVPHQGPHHSDHMQHAYWELR
REMANLHLVTRVQAELLRQLKTAAAGKACTQVGCVEDLGRDSAKLHLANCTAAYKRHPPL
SPHGKATCYAPPSTLPGDRKAFSDKAVLQSWTDNERLTPNDGADFQEHNSYGRNSLEDNS
WVFPSPPKSSETAFGESKSKILPSPNLPPLHYLDQHNQNCLYKS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggacacactggtagaagatgacatctgcattctgaatcatgagaaggcccacaaaaga
gaggcagtgaccccactctcagcgtatcctggagatgagtctgttgcttcccattttgcc
ctggtcactgcttatgaagacatcaagaagagacttaaggattcagagaaagaaaactcc
ttcttaaagaaaagaataagggctttggaagaaaagcttgttggagctcgagtagaagaa
gaaacaagttctgtgggccgagaacaagtgaacaaggcctaccacgcttaccgggaggtt
tgcatcgacagagacaacctgaagagcagactggagaagataagtaaagacaactcggag
tccttgagagcgctgaccgagcagctgcagtgtaaagaagtagagctcctgcagctcaga
actgaggtggagacgcagcaggtgatgaggaatttaaatccaccctcgtccaactgggag
gtggaaaagctaagctgtgacttgaagatccatggtttggaacaagagctggaactactg
aggaaagaatgtagtgacctcagaacagagctacagaaagccagacagacgggtccatct
caggaagacattctgcaggacagagatgtcatcaggccgagcttgccgagggaagagcac
gttccacaccagggccctcaccacagtgaccacatgcagcacgcgtactgggagctgagg
agggagatggctaacctacacctggtgactcgggtgcaagccgagctgctcagacagctg
aagacggcagctgcgggcaaagcctgtacccaagtgggatgtgttgaagaccttgggaga
gacagcgcaaaattgcacttggcaaattgtactgcagcttacaaaagacatccccctttg
tcaccacatggcaaagctacgtgttatgctccaccctccactttaccaggagataggaag
gctttctcagacaaagcagttcttcagtcatggacagacaacgagagactgactcctaat
gacggtgcagactttcaggagcacaactcctacgggagaaattctctggaagataactcc
tgggtattcccaagccctcctaaatcaagtgagacagcatttggtgaaagtaaaagcaaa
atcttaccttcacccaacctgccacccctgcattacctggatcagcacaatcagaactgc
ctgtacaaaagttaa

DBGET integrated database retrieval system