KEGG   Rattus norvegicus (rat): 317335
Entry
317335            CDS       T01003                                 

Gene name
Ddx3x
Definition
(RefSeq) ATP-dependent RNA helicase DDX3X
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    317335 (Ddx3x)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    317335 (Ddx3x)
  09172 Infectious disease: viral
   05161 Hepatitis B
    317335 (Ddx3x)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    317335 (Ddx3x)
   03041 Spliceosome [BR:rno03041]
    317335 (Ddx3x)
   03036 Chromosome and associated proteins [BR:rno03036]
    317335 (Ddx3x)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     317335 (Ddx3x)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     317335 (Ddx3x)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     317335 (Ddx3x)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    317335 (Ddx3x)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    317335 (Ddx3x)
SSDB
Motif
Pfam: Helicase_C DEAD UTP25
Other DBs
NCBI-GeneID: 317335
NCBI-ProteinID: NP_001101716
RGD: 1564771
Ensembl: ENSRNOG00000023383
UniProt: D4ADE8
Position
X
AA seq 311 aa
MLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGST
SENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSI
HGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGR
TGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGSSRGRSKSS
RFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGN
YNSQGVDWWGN
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttagatatggggtttgaacctcagatacgtagaatagttgaacaagacactatgcct
ccaaaaggtgtccgccacactatgatgtttagtgctacttttcctaaggaaatacagatg
ctggcccgtgatttcttagatgagtacatatttctggctgtaggaagagttgggtctact
tcagagaacatcacacaaaaagtggtttgggtggaggagatagacaaaagatcatttctg
cttgacctcctaaatgcaacaggcaaggattccctgactctagtgtttgtggagaccaaa
aagggtgcagattcgctggaggatttcttataccatgaaggatatgcctgtaccagtatc
catggagaccgttctcagagagatagggaagaggcccttcaccagttccgctcaggaaaa
agcccaattctagtagctacagcagtagcagcaagaggactggatatttcaaatgtgaag
catgttattaattttgacctgcctagtgatatcgaagaatatgtgcatcgcataggccgt
acagggcgtgtaggaaaccttggtcttgccacctcattctttaatgaaagaaatataaat
attactaaggatttactggatcttcttgttgaagcaaaacaagaagtgccatcttggttg
gaaaacatggcttttgaacaccactataagggtagcagccgtggacgttctaagagcagt
cgatttagtggagggtttggtgccagagactatcgacagagtagcggcgccagcagttcc
agcttcagcagcagccgcgcaagcagcagccggagtggtggaggtggccatggcagcagc
agaggatttggtggaggtggctatggaggcttttacaacagtgatggatacggaggaaat
tacaactcccagggggttgactggtggggaaactga

KEGG   Rattus norvegicus (rat): 364073
Entry
364073            CDS       T01003                                 

Gene name
Ddx3y
Definition
(RefSeq) uncharacterized protein LOC364073
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
rno05161  Hepatitis B
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    364073 (Ddx3y)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    364073 (Ddx3y)
  09172 Infectious disease: viral
   05161 Hepatitis B
    364073 (Ddx3y)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    364073 (Ddx3y)
   03041 Spliceosome [BR:rno03041]
    364073 (Ddx3y)
   03036 Chromosome and associated proteins [BR:rno03036]
    364073 (Ddx3y)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     364073 (Ddx3y)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     364073 (Ddx3y)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     364073 (Ddx3y)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    364073 (Ddx3y)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    364073 (Ddx3y)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 364073
NCBI-ProteinID: NP_001102328
RGD: 1309586
Ensembl: ENSRNOG00000002501
UniProt: D3ZN21
Position
13
AA seq 659 aa
MSHVAEEDELGLDQQLAGLDLTSPDSQSGASTASKGRYIPPHLRNREATKASYDKDSSRW
SKDKDAYSSFGSRSDTRAKSSFFSDRGSGSRGRFDDRGRSDYEGVGSRGGRSGFGKFERG
GNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESF
SDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQI
YTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYG
GADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIR
RIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV
EEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREE
ALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLAT
SFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGGSRGRSKSRFSGGFGARDYR
QSSGASSSSFSSGRASNSRSGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcagaggaagatgagcttgggctggaccagcagttggctggcctagac
ctgacgtctccagacagccagagcggggcaagcacagccagcaaagggcgctacatccct
cctcacctgcggaacagggaggctacgaaagcgtcctacgacaaagacagctcacggtgg
agtaaagacaaggatgcctacagcagctttggttcccgcagtgacacgagagccaagtcg
agtttcttcagcgaccgcggaagtggctccagaggaaggtttgatgaccgcgggcggagt
gactatgagggcgttggcagccgtggaggtagaagtggctttggcaaatttgagcggggc
gggaacagtcgctggtgtgacaaagcagacgaggatgactggtctaaaccactcccacca
agcgaacgcttggaacaggagctcttttctggaggcaatactgggattaactttgagaaa
tatgatgacattccagttgaagcgacagggaataactgccctccacatattgaaagtttc
agcgacgtcgagatgggagaaattattatgggaaacatcgagctcactcgttatacacgc
ccaactccggtacaaaagcatgctattcctattatcaaggagaaaagagacttgatggct
tgtgctcaaacagggtctggaaaaacggcagcttttcttctacctatcttgagtcagatc
tatacagatggtccaggtgaggctttgagggccatgaaggagaatggaaagtatgggcgt
cgcaaacagtatccgatctccttggttttggctccgaccagagaattggcagtgcagatc
tatgaggaggccaggaaattctcataccgatctcgagttcgaccttgtgtggtttatggt
ggagctgatattgggcagcagattcgagacttggaacgtggctgtcacttgttagtagct
actccaggacggctagtggacatgatggagagaggaaagatcggactggacttctgcaaa
tacttggtgttagacgaagcggatcgaatgttggacatgggctttgagcctcagatacga
agaatagttgaacaagacaccatgcctccaaaaggtgtccgtcacactatgatgtttagc
gctacttttcctaaggaaatacagatgctggctcgggatttcttggatgaatatatcttt
ctggccgtaggaagagtcggatctacttctgagaacatcacacagaaagttgtgtgggtg
gaagaagcagacaagcggtcatttctgcttgacctcctgaatgcgacaggcaaggattcc
ctgatattggtgttcgtggaaaccaaaaagggtgcagattctctggaggatttcttatac
catgaaggatatgcttgtaccagtattcatggagaccgatctcagcgagatagggaagag
gcccttcaccaattccgatcaggaaaaagtccaattctcgtggctacagcagtagcagca
agaggactggatatttccaatgtgaaacatgtcatcaatttcgacttgcctagtgacatc
gaagaatatgtgcatcgaattggccgtacaggtcgtgttggaaaccttggccttgccacc
tcattcttcaacgagaggaacataaatattaccaaagatttattggatcttcttgttgaa
gcaaaacaagaagtgccatcttggctagaaaacatggcttttgaacatcattacaagggt
ggcagtcgtggacggtccaagagcagatttagtggaggatttggtgctagagactatcga
caaagtagcggtgccagcagttccagcttcagcagtggccgtgctagcaacagtcgcagt
ggtggaggcagccatggcagcagcagagggtttggtggaggtagctatggaggcttttac
aatagtgatggatatggaggaaattatagctcccagggggttgactggtggggtaactga

DBGET integrated database retrieval system