KEGG   Rattus norvegicus (rat): 353307
Entry
353307            CDS       T01003                                 

Symbol
Slc29a3
Name
(RefSeq) equilibrative nucleoside transporter 3
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    353307 (Slc29a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    353307 (Slc29a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   353307 (Slc29a3)
SSDB
Motif
Pfam: Nucleoside_tran CLN3
Other DBs
NCBI-GeneID: 353307
NCBI-ProteinID: NP_853670
RGD: 727811
Ensembl: ENSRNOG00000000568
UniProt: Q80WK7
Position
20
AA seq 475 aa
MAFASEDIAYHSSNAVYRVPSNRHEADQEALLGKPLDYPAPGLQRPEDRFNGAYIIFFCL
GIGGLLPWNFFVTAKEYWAFKLRNCSSPASGKDPEDADILNYFESYLAVASTVPSLLFLV
ANFLLVNRIRVHVRVLASLSVSLAIFVVMAVLVRVDTSSWTRGFFSIAMACMAIISSSST
IFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVASLVDLAASSDVRDSALAFFLTAAVF
LGLCVGLYLLLPQLEYARYYMRPVVPIHVFSSEDSPPRDAPSTSSVAPASRAVHTPPLGP
ILKKTAGLGFCAVFLYFITALIFPAISTNIQPMHKGTGSPWTSKFYVPLTVFLLFNFADL
CGRQVTAWIQVPGPRSKLLPILAVSRVCLVPLFLLCNYQPRSHLTLVLFQSDIYPILFTC
LLGLSNGYLSTLVLMYGPKIVPRELAEATSVVMLFYMSLGLMLGSACAALLEHFI
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcctttgcctctgaggacattgcataccacagctcaaatgctgtctacagagtccca
agcaaccgtcatgaagctgaccaggaagccctactgggaaaaccactagactacccagcc
ccaggcctgcagaggccagaggaccgcttcaatggtgcctatatcatcttcttctgcctg
ggaattggcggcctactaccctggaacttttttgtcactgccaaagagtactgggcattt
aaactccgaaactgctccagcccagcctccgggaaggacccagaggatgcagacatcctg
aactactttgagagctacctggcggttgcttccactgtgccttccctgctgtttctggtg
gctaacttcctgcttgtcaacaggatccgggtgcatgtccgagttctggcctcactgtcc
gtctccctggccatctttgtggttatggccgtgctggtgagggtggacacttcttcctgg
acccggggcttcttcagcatcgccatggcgtgcatggccatcatcagcagctcctccacc
atcttcaatagcagcgtgtatggcctgacgggctcgttccccatgaggaatgcccaggca
ctgatatcaggaggagccatgggagggacagtcagtgctgtggcctccctggtggacctg
gcagcatccagtgacgtgcgagacagtgcgctggccttcttcctcacagcagcagtcttc
cttgggctctgtgtggggctctacctactgctgccccaactggagtatgccaggtactac
atgaggccggttgtcccaatccacgtgttttctagtgaagacagcccaccccgggatgct
cccagcacctcctccgtggcccctgcatccagagcagtgcacacgccacccctcggaccc
atcctgaagaagacagctggcctggggttctgcgccgttttcctctacttcatcaccgcc
cttatcttccccgctatctccaccaacatccagcccatgcacaagggcaccggctctcca
tggacctccaagttctatgtgcccctcaccgtcttcctccttttcaactttgctgacctc
tgcggccgacaggtcacagcctggatccaggtgccaggtcctaggagcaagctgctcccc
atactggcagtctctcgcgtctgcctcgtgcctctcttcctgctctgtaactaccagcca
cgctcacacctgactctggtgcttttccagtctgacatctaccctatactcttcacctgc
ctcttggggctcagtaatggctacctcagcacgctggtgctcatgtatgggcccaagatt
gtgccccgggagctggctgaggccaccagtgtggtgatgctgttctacatgtcactgggt
ttgatgctgggctcagcctgtgcggccttgcttgagcactttatctag

KEGG   Rattus norvegicus (rat): 63997
Entry
63997             CDS       T01003                                 

Symbol
Slc29a1
Name
(RefSeq) equilibrative nucleoside transporter 1
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    63997 (Slc29a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    63997 (Slc29a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   63997 (Slc29a1)
SSDB
Motif
Pfam: Nucleoside_tran
Other DBs
NCBI-GeneID: 63997
NCBI-ProteinID: NP_113872
RGD: 61899
Ensembl: ENSRNOG00000019752
UniProt: O54698
Position
9
AA seq 457 aa
MTTSHQPQDRYKAVWLIFFVLGLGTLLPWNFFITATQYFTSRLNTSQNISLVTNQSCEST
EALADPSVSLPARSSLSAIFNNVMTLCAMLPLLIFTCLNSFLHQKVSQSLRILGSLLAIL
LVFLVTATLVKVQMDALSFFIITMIKIVLINSFGAILQASLFGLAGVLPANYTAPIMSGQ
GLAGFFTSVAMICAVASGSKLSESAFGYFITACAVVILAILCYLALPWMEFYRHYLQLNL
AGPAEQETKLDLISEGEEPRGGREESGVPGPNSLPANRNQSIKAILKSIWVLALSVCFIF
TVTIGLFPAVTAEVESSIAGTSPWKNCYFIPVACFLNFNVFDWLGRSLTAICMWPGQDSR
WLPVLVACRVVFIPLLMLCNVKQHHYLPSLFKHDVWFITFMAAFAFSNGYLASLCMCFGP
KKVKPAEAETAGNIMSFFLCLGLALGAVLSFLLRALV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgacaaccagtcaccagcctcaggacaggtataaggctgtctggctcatcttctttgtc
ctgggtctggggacactgctcccctggaatttttttataacagcaacccagtatttcaca
agccgcctgaacacgtcccagaatatatccttggtcaccaaccaatcatgcgaaagcacc
gaggccttggctgacccctcagtgtccttgccagcccggagttctctcagtgccatcttc
aacaatgtcatgaccctgtgtgccatgttgcccttgctgatcttcacctgcctcaactct
ttcctgcatcagaaggtgtctcagtcccttcggatcttgggcagcctgctggctatcctg
ttggtgttcctcgtcactgccaccctggtgaaggtgcagatggatgccctgtccttcttc
atcatcaccatgatcaagattgtgctcattaactcatttggtgccattttgcaagccagc
cttttcggtctggcaggcgtcctgccggccaactacacagcccccatcatgagtggccag
ggcctggctggcttcttcacctctgttgccatgatctgtgccgtcgccagtggctctaag
ctgtcagaaagtgcttttggttacttcatcacggcctgtgcagttgtcattctggccata
ctgtgttacctggccctgccttggatggaattctaccgacattacctgcagctcaacctt
gcggggcctgcagagcaggagaccaagttggatctcatcagtgaaggagaggagccaaga
ggaggaagagaggaatctggggtgccaggccccaactctctacccgccaacagaaaccaa
tccatcaaagccatactgaagagtatctgggtcctggctctgtctgtctgtttcatcttc
acagtcaccattgggttgttccctgctgtgactgctgaggtggaatccagcatcgcaggc
acaagtccctggaaaaactgctacttcatccctgtggcctgcttcctgaatttcaatgtc
tttgactggctaggccggagcctcacagctatttgcatgtggcctggtcaggacagccgc
tggttgccggtcctggtcgcctgcagggttgtgtttatccccctgctgatgctctgcaat
gtgaagcagcaccactacctgccctccctctttaagcatgatgtctggttcatcaccttc
atggccgcctttgccttctccaatggctacctcgccagcctctgcatgtgcttcgggccc
aagaaagtcaaaccggctgaggcagagactgccggaaacatcatgtccttctttctgtgt
ctgggcctggctctgggagctgtgttgtccttcttgttaagggcacttgtgtga

KEGG   Rattus norvegicus (rat): 65194
Entry
65194             CDS       T01003                                 

Symbol
Slc29a2
Name
(RefSeq) equilibrative nucleoside transporter 2
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    65194 (Slc29a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    65194 (Slc29a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   65194 (Slc29a2)
SSDB
Motif
Pfam: Nucleoside_tran
Other DBs
NCBI-GeneID: 65194
NCBI-ProteinID: NP_113926
RGD: 69296
Ensembl: ENSRNOG00000050201
UniProt: O54699
Position
1
AA seq 456 aa
MAHGNAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQGRLAGTNSSAETPSTNHTSP
TDTFNFNNWVTLLSQLPLLLFTLLNSFLYQCIPESVRILGSLLAILLLFALTAALVKVDL
SPGLFFSITMASVWFINSFCAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLTS
LASGVDPQTSALGYFITPCVGILLSIICYLSLPHLKFARYYLTKKPQAPVQELETKAELL
GADEKNGIPVSPQQAGPTLDLDPEKELELGLEEPQKPGKPSVFVVFRKIWLTALCLVLVF
TVTLSVFPAITAMVTTSSNSPGKWSQFFNPICCFLLFNVMDWLGRSLTSYFLWPDEDSQL
LPLLVCLRFLFVPLFMLCHVPQRARLPIIFWQDAYFITFMLLFAISNGYFVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcgcacggaaacgcccctcgggacagctaccacctggtcgggatcagcttcttcatt
ttgggtctgggcaccctcctcccctggaacttcttcattaccgccatcccgtacttccag
gggcggttggcagggaccaacagcagcgctgagaccccgagcaccaaccacaccagtccc
acagacaccttcaacttcaacaactgggtgacactgctgtcccagctgcctctactgctc
ttcacgctcctcaactccttcttgtatcagtgcatccctgagtcggtgcgtattctgggc
agcctgctggccatactactgctctttgccctgacagcagcgctggtgaaggtggatttg
agccccgggctgttcttttccatcaccatggcatccgtctggttcatcaattccttctgt
gcagtgcttcaaggcagcctctttgggcagctgggtaccatgccttctacctacagcacc
ctcttcctcagtggccagggcctggctgggatcttcgctgcccttgctatgctcacgtcc
ttagccagtggcgtggacccccagacctctgcccttgggtacttcatcacaccctgtgtg
ggcatcctcctctccatcatatgttacctcagtctgccccatctgaagtttgcccgttac
tacctgaccaagaagcctcaggccccagttcaggagctggagaccaaagctgagctcctc
ggagctgatgagaagaatgggattcctgtcagcccccagcaggcaggcccaactctggat
cttgacccagagaaggagctggagctggggctggaggaaccacagaagccaggaaaacct
tcggtctttgtcgtcttccggaagatctggctgacggcgctgtgccttgtgttggtcttc
acagtcaccctgtcggtctttcctgctatcacagccatggtgaccaccagctccaatagc
cccgggaagtggagtcagttcttcaaccctatctgttgcttcctgctcttcaacgtcatg
gattggctgggccggagcctgacttcctacttcctgtggccagatgaggacagccagctg
ctgcccctgctggtgtgcctgcgcttcctgttcgtgcccctcttcatgctgtgtcatgtg
ccccagcgtgcccggctgcccatcatcttctggcaggatgcctacttcatcacattcatg
ctgctcttcgccatttccaacggctacttcgtgtctctcaccatgtgtctggcacccagg
caggtgctgccgcatgagagggaggtggccggagccctcatgaccttcttcctggccctg
ggactctcctgcggagcctctctctccttcctctttaaggctttactctga

DBGET integrated database retrieval system