KEGG   Rattus norvegicus (rat): 359726
Entry
359726            CDS       T01003                                 

Gene name
Rnasel
Definition
(RefSeq) 2-5A-dependent ribonuclease
  KO
K01165  ribonuclease L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05160  Hepatitis C
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    359726 (Rnasel)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    359726 (Rnasel)
   05164 Influenza A
    359726 (Rnasel)
   05168 Herpes simplex virus 1 infection
    359726 (Rnasel)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank_3 Ank Ribonuc_2-5A Pkinase PK_Tyr_Ser-Thr Kdo
Other DBs
NCBI-GeneID: 359726
NCBI-ProteinID: NP_872614
RGD: 727933
Ensembl: ENSRNOG00000027017
UniProt: Q80WM6
Position
13
AA seq 738 aa
METTDHSTPQCGSASAGGQKTVGKDDYLLIEAVNKGDADRVQQLLEQGADANVCEESGGW
TPLHNAVQSGRVDIVNLLLRYGADPHRRKKNGATPFIVAGICGDVSLLQIFLSRGANINE
RDMYGFTAFMEAAEYGNVEALKFLFAEGADVNLRRETTEDRRRLKQGGATALMSAAENGH
PEVVRILLDEMKAEADARDNMGRNALIRSLLNRDCENVEIHVEEITSVLIQYGADINVRG
EGEKTPLISAVKRKHTGLVQMLLSQEGIKVNDRDSEGKTALQIAVELKLKEIVRLLLEKG
ADTKCGDLVWIAKRNYDHGLVKLLLSYEANHDTNPPAKDWLPHSARWGEALERLHSVSRP
MTGKLKIFMNDDYKIASTSEGGIYLGIYDNREVAVKVFCENSSRGRKEVSCLRDCGDHSN
LLTFYGSEEHKGSLYVCVSLCESTLEKFLNVPREEPMEKGEDKFALSVLLSIFKGVQKLH
MHGYSHQNLQPPNILIDSEKAVRLADFDESIQWMRESQTVQRDLEDLGRLVLYVVNKGEI
PFETLKGQNDEELLTIAPNEETKDLVHCLFSPGENVKNCLMDLLGHPFFWTWENRYRTLR
DVGNESDIKVRNNKSKLLKLLQPQTHAPSRSFDRWTSKIDKRVMSDMNGFYKSRKGYRDT
VGDLLKFIRNIGEHINEEKNRQMKEILGDPSRYFQETFPDLVIYIYKKLKETEFRKHFPQ
PPPSLSVPEAAGPGGVQS
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggagaccacggatcatagcacacctcagtgtggatccgcatcagcaggtggtcagaag
accgttggcaaagatgattatttgttgatagaagctgttaacaagggagatgctgacagg
gtccagcaattgttagaacaaggggctgatgccaatgtctgtgaagaatctgggggctgg
acacctttgcacaacgcggtgcagtctggcagggtagatattgtgaatctcctgcttcgt
tatggtgctgaccctcatcggaggaagaagaatggggccacccccttcatcgttgctggg
atctgtggagatgtgagtctgctccagattttcctctctcgaggtgcaaacatcaatgag
cgtgacatgtacggattcacggctttcatggaagctgctgagtatggtaacgttgaagcc
ctaaaattcctttttgctgaaggggccgatgtgaatttgagacgggagacaacggaggac
agaaggcgactgaagcaaggaggggccacggctctcatgagcgctgcggagaatggccac
ccggaagtcgtgagaattctcctcgatgaaatgaaggcagaagccgatgctcgggacaat
atgggcagaaatgccttgatccgttctctgctgaaccgcgattgtgaaaatgttgaaatt
catgtggaggagatcacttcagttctgattcaatacggcgctgatattaatgtgagaggg
gaaggtgagaagacacctctgatctcagcagtgaagaggaagcacacaggtttggtgcag
atgctcctgagtcaggagggcataaaggtgaatgacagagatagcgagggcaagacggcg
ctgcaaattgctgttgaactcaaactgaaggaaatcgtccggttgcttcttgaaaaggga
gccgataccaagtgtggcgatcttgtttggatagccaagaggaattatgaccatggtcta
gtaaaacttcttctctcgtatgaagctaatcacgacaccaaccctcctgctaaagactgg
ttgcctcacagtgcacgctggggggaggccttggaaagactccacagtgtgtctcgaccc
atgactggcaaactcaagatcttcatgaatgatgactataaaattgccagcacttctgaa
gggggcatctacctagggatctatgacaatcgagaggtggctgtgaaggtcttctgtgag
aatagctcacgtggacgtaaggaagtctcttgtctgcgggactgtggagaccacagtaac
ttactgactttctatggaagcgaggagcacaagggcagtttatatgtgtgtgtgtccctg
tgtgagtcgacattggaaaagttcctgaatgtgcccagagaggaacctatggagaaaggg
gaagacaagtttgccctcagtgtcctattgtctatatttaagggtgttcaaaaactacac
atgcatggatattcccatcagaacctgcaaccgccaaacatcttaatagattctgagaaa
gctgtccggctggcagattttgatgagagcatccagtggatgagagagtcacagacggtc
cagagagacttggaggaccttggacgactggttctctatgtggtaaacaaaggtgagatc
ccctttgagacactgaagggtcagaatgatgaagaattgcttacgatcgctccaaatgag
gagactaaggacctcgttcattgcctgttttctcctggagaaaatgtaaagaactgtctg
atggacctgcttggccatcctttcttttggacttgggagaaccgctatagaacgcttcgg
gatgtgggaaatgaatctgacatcaaagtacgaaataataaaagtaaacttctcaagcta
ctgcagcctcagacacacgcgccttccagaagctttgatcggtggacgtctaagatcgac
aaacgtgtcatgtctgacatgaatggtttctataaatcccgaaagggttatcgggatact
gtaggtgatctgctgaagtttattcggaatataggagaacacatcaatgaggaaaaaaac
aggcaaatgaaggagatacttggagacccttctcgttattttcaggagacatttccagat
cttgtaatctatatctacaagaaactaaaggaaacggaattcagaaaacactttcctcag
cctccaccaagcctcagcgtgccagaggcagcgggaccagggggtgtacagagctga

DBGET integrated database retrieval system