KEGG   Rattus norvegicus (rat): 360908
Entry
360908            CDS       T01003                                 

Gene name
Cdc7
Definition
(RefSeq) cell division cycle 7-related protein kinase
  KO
K02214  cell division control protein 7 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    360908 (Cdc7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    360908 (Cdc7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    360908 (Cdc7)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     360908 (Cdc7)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CDC7 family
   360908 (Cdc7)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    360908 (Cdc7)
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH
Other DBs
NCBI-GeneID: 360908
NCBI-ProteinID: NP_001101822
RGD: 1308351
Ensembl: ENSRNOG00000002105
UniProt: D4A8S5
Position
14
AA seq 565 aa
MEEPMAFSPLRGCDRCPADDSLKKYEQSVKLSGIKRDIEELCEAVPQLVSVFKIKDKIGE
GTFSSVYLATAQLQEGREEKIALKHLIPTSHPVRIAAELQCLTVAGGQDNVMGVKYCFRK
NDHVVIAMPYLEHESFLDILNSLSFQEVREYMFNLFVALKRIHQFGIVHRDVKPSNFLYN
RRLKKYALVDFGLAQGTRDTKIELLKFVQSEAQQEDCSRNKCHGVIGHKGPLSRPAPKNV
DQHITTKTSVKRSYANAQIHIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISHESPAEK
LIKQSKTVDIMSRKLATKKMAVSTKAVNSSMRDSARSCPAALTCDCYGTDRVCSVCLSRR
QQVAPRAGTPGFRAPEVLTKCPDQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQI
MTIRGSRETIQAAKAFGKSILCSKEVPAQDLRTLCERLRGPDSANPKSAVDPPGNTGHHP
AASESTDHKAPHAPASPAQHSEDSLYKRGSGGGRRHPRDRTANPEGWDSVPDDAYDLLDK
LLDLNPASRITAEAALVHPFFKDVC
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggaggagccaatggcgttttctcccctgcgtggctgtgacaggtgtccggctgatgac
tctttaaaaaaatatgagcagagtgttaaactttcaggtattaaaagagatattgaggag
ctttgcgaagccgtaccacagcttgtcagtgtgttcaaaattaaggacaaaatcggagaa
ggcaccttcagctctgtttatttggccacagcgcagctgcaagaaggacgtgaagagaag
attgcgctgaaacacttaattcccacaagccatcctgtgaggattgcggccgagcttcag
tgtctgaccgtcgcaggggggcaggacaatgtcatgggagtgaagtactgcttcaggaag
aacgaccatgtggtgattgctatgccctacctggaacatgagtcttttctggacattttg
aattctctttcctttcaagaagttcgagaatatatgttcaaccttttcgtagctctgaag
cggattcaccagtttggcattgttcaccgtgatgtgaagcccagtaactttttatacaat
agacgcctgaaaaagtatgccttggtggacttcggtttggcccaaggaacccgtgacaca
aagatagagctgctcaagtttgtccagtctgaagctcagcaggaagattgttcacgaaac
aaatgtcatggagtcattggacacaagggcccactgagtcgcccagcacctaaaaatgtg
gatcagcacatcaccacaaaaacttctgtcaaaagatcctatgcaaacgcacagattcac
attaagcaaggaaaagacggaaaggaggggtctgtaggcctttctgtccagcgctctgtt
tttggagaaagaaatttcaatatacacagctccatttcacatgagagccctgcagagaaa
ctcatcaagcaatcgaagactgtggacataatgtcaagaaagctagcaacaaaaaagatg
gccgtttctacaaaggctgtgaatagctcgatgagggactctgccaggtcctgcccagct
gccctcacgtgcgactgctatggaacagatagagtgtgcagcgtttgcctgtcgaggcgg
cagcaggttgcccctagggcaggcacaccaggattcagagcgccagaggtcctgacaaag
tgtcctgaccagactacagcgattgacatgtggtctgcaggtgtcatattcctttccttg
ctcagtgggcggtacccgttttacaaggccagcgatgacttaactgctttggcccaaatc
atgacaattcgaggatccagggaaactatccaggctgctaaagcttttggcaaatcaatt
ttgtgtagcaaagaagtcccagcacaagacttgaggacgctctgtgagagactacggggt
ccggactctgccaatcccaagtctgctgttgatcctccagggaatactggccaccaccct
gctgcttcggagagcactgaccataaagcgccccatgcaccggcctctccggcacagcac
tcggaggattccctgtataaaaggggcagcggcggtggtcggagacatcccagagatcga
actgccaacccagagggctgggactcggtgcctgatgacgcctatgacctgctcgataaa
cttctggacttaaacccagcctccaggataacagcagaagcggccttggtccatccgttc
tttaaagatgtgtgctga

DBGET integrated database retrieval system