KEGG   Rattus norvegicus (rat): 361321
Entry
361321            CDS       T01003                                 

Gene name
Atg12
Definition
(RefSeq) ubiquitin-like protein ATG12
  KO
K08336  ubiquitin-like protein ATG12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    361321 (Atg12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    361321 (Atg12)
   04136 Autophagy - other
    361321 (Atg12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    361321 (Atg12)
   04622 RIG-I-like receptor signaling pathway
    361321 (Atg12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361321 (Atg12)
   04121 Ubiquitin system [BR:rno04121]
    361321 (Atg12)
   03029 Mitochondrial biogenesis [BR:rno03029]
    361321 (Atg12)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    361321 (Atg12)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   361321 (Atg12)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    361321 (Atg12)
SSDB
Motif
Pfam: APG12 ATG8
Other DBs
NCBI-GeneID: 361321
NCBI-ProteinID: NP_001033584
RGD: 1306306
Ensembl: ENSRNOG00000000157
UniProt: Q2TBJ5
Position
18
AA seq 141 aa
MAEDPEAVLQLPAAPAAAAGESLLELSPETAIPEPPSSVAVSPGTEEPPGDTKKKIDILL
KAVGDTPIMKTKKWAVERTRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTL
YECFGSDGKLVLHYCKSQAWG
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcagaagacccagaggctgtgctgcagctccccgcggctccggctgctgcggcgggc
gagagccttttggagctctccccagaaacagccatcccagagcccccgtcttcggttgca
gtttcgcccggtacggaggaacctcccggagacaccaagaaaaaaattgacatcctgctg
aaggctgtaggagacactcccataatgaaaacgaagaaatgggctgtggagcggacccgg
actgtccaagcactcatcgacttcatcagaaaattcctcagactgctggcctcggagcag
ttgtttatttatgtgaatcagtcctttgccccttccccagaccaagaagttgggactcta
tatgagtgttttggcagtgatggtaaactggtcctacattactgcaaatcacaggcatgg
ggatga

DBGET integrated database retrieval system