KEGG   Rattus norvegicus (rat): 361585
Entry
361585            CDS       T01003                                 

Gene name
Ube3a
Definition
(RefSeq) ubiquitin-protein ligase E3A
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    361585 (Ube3a)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    361585 (Ube3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    361585 (Ube3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361585 (Ube3a)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     361585 (Ube3a)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   361585 (Ube3a)
SSDB
Motif
Pfam: HECT AZUL Atrophin-1
Other DBs
NCBI-GeneID: 361585
NCBI-ProteinID: NP_001178766
RGD: 1306361
Ensembl: ENSRNOG00000015734
UniProt: F1M7B8
Position
1
AA seq 868 aa
MATACKRSSGESQSEDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLR
MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGASNNSEIKMNKKEEFKEVDY
LTEEKVYEIYEFCREREDYSPLIRVIGRIFSSAEALVQSFRKVKQHTKEELKSLQEKDED
KDEDEKEKAACSAAAMEEDSEASSSRMGDSSQGDNNVQKLGPDDVTVDIDAIRRVYSSLL
SDEKIETAFLNALVYLSPNVECDLTYHNVYTRDPNYLNLFIIVMENRNLHSPEYLEMALP
LFCKAMSKLPLAAQGKLIRLWSKYSADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDA
IVAASKCLKMVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDP
LETEIGVKTLDCRKPLISFEEFINEPLNDVLEMDKDYTFFKVETENKFSFMTCPFILNAV
TKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMEN
PADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATRLFWFNPSSFE
TEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFCDLGDSHPILYQSLKDLLE
YEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVSLYSDYILNKSVE
KQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVI
REFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVL
LLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggccacagcttgtaaaagatcatcaggagaatcccagtctgaggacattgaagctagc
cgaatgaagcgagcagctgcaaagcatctaatagagcgctactaccatcagttaactgag
ggctgtggaaatgaggcctgcacgaatgagttctgtgcttcctgtccaacttttcttcgt
atggataacaatgcagcagctattaaagctcttgagctttataaaattaatgcaaaactc
tgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcaaaaggt
gcatctaacaactcagagataaaaatgaacaagaaggaagagtttaaagaggtggactac
ctaactgaagagaaagtatatgaaatttatgaattttgtagggagagagaggattactcc
cctttaattcgtgtaattggaagaatattttctagtgctgaggcactggttcagagcttt
cggaaagtcaaacagcacactaaggaggaattgaaatctcttcaagagaaggatgaagac
aaggatgaagatgaaaaggaaaaagctgcgtgttctgctgctgctatggaagaagactca
gaagcatcttcttcaaggatgggtgatagctcacagggagacaacaatgtacaaaaatta
ggtcctgatgatgtgactgtggatattgatgctataagaagggtctacagcagtttgctc
tctgatgaaaaaatagaaactgccttcctgaatgcacttgtatatctgtcacctaacgtg
gaatgtgatttgacatatcataatgtgtacactcgagaccctaattatctcaatttgttc
attattgtaatggaaaataggaatctccacagtcctgaatatctggaaatggcattgccg
ttattttgcaaagctatgagtaagctaccccttgcagctcaaggaaaactgattaggctg
tggtctaaatacagtgctgaccagattcggagaatgatggaaacatttcagcaacttatt
acctacaaagtcataagcaatgaatttaatagccgaaatctagtgaatgatgatgatgcc
attgttgctgcttcaaagtgtttgaaaatggtttactatgcaaatgtagtgggaggggac
gtggacacaaatcataatgaggaagatgatgaagagcctatacctgagtccagtgaattg
acacttcaggagcttctgggagaggaaagaagaaataagaaaggtcctcgagtggatcca
ctagaaaccgaaattggcgttaaaactctagattgtcgaaaaccacttatctcctttgaa
gaattcattaatgaaccactgaatgatgttctagaaatggacaaagattatacttttttc
aaagttgaaacagagaacaaattctcttttatgacatgtccctttatattgaatgctgtc
acaaagaatctgggattgtattatgacaatagaattcgcatgtacagtgaaagaagaatc
actgttctttacagcctagttcaaggacagcagttgaatccatatttgagacttaaagtc
agacgtgaccatattatagatgatgcacttgtccggctagagatgatcgctatggaaaat
cctgcagacttgaagaaacagttgtatgtggaatttgaaggagaacaaggagtagatgag
ggaggcgtttccaaagagttttttcagttggttgtggaggaaatctttaatccagatatt
ggtatgttcacatacgatgaagctacaagattattttggtttaatccatcttcttttgaa
actgagggtcaatttactctgattggcatagtcctgggtctggctatttacaataactgt
atactggatgtccattttcccatggttgtgtacaggaagctaatggggaaaaaaggaacg
ttttgtgacttgggagactctcacccaatcttatatcagagtttaaaggatttattggaa
tatgaagggaatgtggaagatgatatgatgatcactttccagatatcacagacagatctt
tttggtaacccaatgatgtatgatctaaaagaaaatggtgataaaattccaattacaaat
gaaaacaggaaggaatttgtcagtctctattcagactacattctcaataaatctgtagaa
aaacaattcaaggcatttcgcagaggttttcatatggtgactaatgaatcacccttaaaa
tacttattcagaccagaagaaattgaattacttatatgtggaagccggaatctcgatttc
caggcactagaagaaactacagagtatgatggtggctatacgagagaatctgttgtgatt
agggagttctgggaaattgttcattcgtttacagatgaacagaaaagacttttcctgcag
tttacaacaggcacagacagagcacctgttggaggactcggaaaattgaagatgattata
gccaaaaatggcccagacacagaaaggttacctacatctcatacttgctttaatgtcctt
ttacttccggaatattcaagcaaagaaaaacttaaagagagattgctgaaggccatcaca
tatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system