KEGG   Rattus norvegicus (rat): 361662
Entry
361662            CDS       T01003                                 

Gene name
Bub3
Definition
(RefSeq) mitotic checkpoint protein BUB3
  KO
K02180  cell cycle arrest protein BUB3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    361662 (Bub3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    361662 (Bub3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    361662 (Bub3)
   03036 Chromosome and associated proteins [BR:rno03036]
    361662 (Bub3)
Spliceosome [BR:rno03041]
 Complex A
  Other components
   Complex A specific factors
    361662 (Bub3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     361662 (Bub3)
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 361662
NCBI-ProteinID: NP_001041371
RGD: 1306654
Ensembl: ENSRNOG00000020643
UniProt: Q4FZS2
Position
1
AA seq 326 aa
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaccggttcgaatgaattcaagctgaaccagccacccgaggatggcatctcctcggtt
aagttcagccccaacacctcccagttcctcctggtctcctcctgggatacgtccgtgcgc
ctctacgatgtgcccgccaattccatgaggctcaagtaccagcacactggtgctgtcctg
gactgcgccttctacgatccaacacatgcctggagtggaggactagatcatcaactgaaa
atgcatgatttgaatactgatcaagaaaatcttgttggaactcatgatgcccctatcaga
tgtgtcgaatactgtccagaagtgaacgtgatggttactggaagttgggatcagacagtt
aaactgtgggatcccagaactccttgtaatgctgggacgttctctcagccggaaaaggtc
tacaccctgtcggtgtctggggacaggctgattgtgggcacagcaggccgccgagtactg
gtgtgggacctgaggaacatgggctacgtgcagcagcgcagggagtccagcctgaagtac
cagactcgctgtatccgagccttcccgaacaaacagggttatgtgttgagctccattgaa
ggccgagtagctgtggaatacttggacccgagccctgaggttcagaagaagaagtacgcc
ttcaagtgtcacaggctaaaggagaacaacatcgagcagatttacccagtcaacgccatc
tcctttcacaatatccacaacacatttgccacaggaggctctgatggatttgtaaatatt
tgggacccatttaacaaaaagcgcctgtgccagttccatcgctaccccaccagcatcgca
tcccttgccttcagtaatgatggaactacgcttgcaatcgcatcgtcatatatgtatgaa
atggatgataccgagcatcctgaagatggtatcttcattcgccaagtgacagatgcagag
acaaagcccaagtccacgtaa

DBGET integrated database retrieval system