KEGG   Rattus norvegicus (rat): 362304
Entry
362304            CDS       T01003                                 

Gene name
Orc5
Definition
(RefSeq) origin recognition complex subunit 5
  KO
K02607  origin recognition complex subunit 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    362304 (Orc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    362304 (Orc5)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    362304 (Orc5)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     362304 (Orc5)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    362304 (Orc5)
Motif
Pfam: ORC5_C AAA_16 AAA_22 Kinesin Microtub_bd Arf AAA_7 AAA_24
Other DBs
NCBI-GeneID: 362304
NCBI-ProteinID: NP_001014208
RGD: 1561088
Ensembl: ENSRNOG00000011519
UniProt: Q5M7U2
Position
4
AA seq 435 aa
MSHLESMVLCREAQVSTLQSLFGEREHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHAF
VNCVECFTSRLLLEQILNKLSHLSSSEAECSTETTCETFNDFVRLFKQVTSAEHLKDQTV
YIVLDKADYLRDMEANLLPGFLRLQELTDRNVTVIFLSEIIWEKFRPNTGCFEPFVLHFP
DYSIGNLQKILSHDHPPGYSADFYSAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEAGERDTRKLWRNIEPHLKKAMQTVYLREVSSSQWETLQKDATDLGQLKGLSAYTHV
ELPYYSKFILIAAYLASYNPARTDRRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTVVGHEDQLNGPKYKCTVSLDFIRSIA
RTVNFDIIKYLYDFL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtctcacttggagagcatggtgctctgtcgagaggcccaagtgtccactttgcagtcc
ctgtttggagagagagagcacttcagctttccgtccatcttcatttatggacacactgcc
agtgggaagacctatgtgacacagacattgttgaaaactttagagctcccacatgccttt
gtgaattgtgttgaatgttttacttcaaggctacttttggaacaaattttaaacaagctg
agtcatcttagttcttcagaggcagagtgttctacagaaacgacttgtgaaacatttaat
gactttgtccggttgtttaagcaagtgaccagtgctgaacatctcaaggatcagactgtg
tatattgttctggataaagctgactatctgagagacatggaagcaaatctcttgcctggg
tttcttaggctgcaagagttgactgacagaaacgtgactgttatcttcctcagtgagatt
atttgggaaaaatttcgtccaaacactggatgcttcgagccatttgtcttacacttccct
gactacagcatagggaaccttcaaaagatcctgtcccacgatcatcctccagggtattca
gctgacttttactctgcctacattaatattctccttggagttttctacactgtctgtcga
gatctgaaagagctcagacacctggcagtgcttaatttccccaaatattgtgagcctgta
gttaaaggagaagcaggtgagcgtgatactcgcaaactgtggagaaatattgaacctcac
ttgaagaaggccatgcagacggtgtatctgagggaggtctcaagttcgcagtgggaaaca
ttacagaaagatgccacagacctgggacagctgaaagggctctcggcgtacacccatgtg
gagcttccatattactccaagtttattcttattgctgcgtaccttgcctcttacaacccc
gcgagaacggacaggaggttcttcctaaagcatcatggaaaaatcaagaaaactaacttt
ctaaagaaacatgagaagacaagcaatcatcttcttggaccaaagccatttccattggac
agattattagcaatattatatagtatagtggacagcagagtggctccaactgcaaacatc
ttctcccagattacctccctagtgactcttcagctgttaaccgtagttggtcatgaagat
caacttaatggaccaaaatacaaatgcacagtttctctagatttcatcagatctattgcg
cggacggtgaactttgacataataaaatacttgtatgatttcttgtga

DBGET integrated database retrieval system