KEGG   Rattus norvegicus (rat): 362491
Entry
362491            CDS       T01003                                 

Gene name
Ripk2
Definition
(RefSeq) receptor-interacting serine/threonine-protein kinase 2
  KO
K08846  receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno05132  Salmonella infection
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    362491 (Ripk2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    362491 (Ripk2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    362491 (Ripk2)
   05152 Tuberculosis
    362491 (Ripk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362491 (Ripk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     362491 (Ripk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   362491 (Ripk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase CARD Kdo
Other DBs
NCBI-GeneID: 362491
NCBI-ProteinID: NP_001178794
RGD: 1309167
Ensembl: ENSRNOG00000009389
UniProt: G3V783
Structure
PDB: 
6GWM

Position
5
AA seq 539 aa
MNGDAICSALPHIPYHKLADLHYLSRGASGTVSSARHADWRVRVAVKHLHIHTPLLDSER
NDILREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPEIAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
YKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTSEENLPFDIPHRGLMISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDI
TFLEAVIQLKKSKIQSASSTIHLCDKKMDLSLNIPASHPPQEESCGSSLLSRNAGSPGTS
RSLSAPQDKGFFHGGPQDCSSSKAYHCPGNHSWDGIISVSQEAAFCDRRASSCSLTVIRP
LLVEKSSERPQPGIAQQWIQSKREAIVSQMTEACLNQSLDALLSRDLIMKEDYELISTKP
TRTAKVRQLLDTSDIQGEEFARVIVQKLKDNKQMGLQPYPEVLLVSRTPSSNVLQNKTL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaacggggacgccatctgcagcgcgctgccccacatcccctaccacaagctcgccgac
ctgcactacctcagccgcggcgcctcaggcaccgtctcgtcggcaagacacgcggactgg
cgggtgcgggtggcagtgaagcacctgcacattcacacgccgctgctcgacagtgaaaga
aatgatatcttacgagaagccgaaatattacataaagcaagatttagttacattcttcca
atattgggaatttgcaatgagcctgaatttttgggcatagttactgaatacatgccaaac
ggatcattaaatgagcttctacacagaaaaactgaatatcctgagattgcatggccattg
agattccgcatcctgcatgaaattgctcttggtgtaaattacctgcacaatatgaacccc
cctctgcttcatcatgacttaaagactcagaatatcttgttggataatgaatttcatgtt
aagattgcagatttcggtttatcaaaatggcgcatgatgtcactctcccaatcacggagc
tacaaatctgcacccgaagggggaacgatcatctatatgccacctgagaactatgaaccg
ggacagaaatcaagggccagcgtgaagcatgatatatacagctatgcggttatcatgtgg
gaagtgttgtccagaaaacagccttttgaagaggtcaccaatcctttgcagatcatgtac
agtgtgtcccagggacatcggcctaacaccagtgaggaaaatttgccatttgatatacct
catcgaggtctcatgatctctctaatacaaagtggatgggcacaaaacccagatgagaga
ccatccttcttgaaatgcttaatagaacttgaaccagttctgagaacatttgaagacata
acttttcttgaagctgttattcagctaaaaaaatcaaagatacagagtgcatcgagtaca
attcacttatgtgataagaaaatggatttatcactgaacatacctgcaagccatcctcca
caggaggaatcatgtggatcctctctgctctctagaaacgctggttctcctggaacctcc
aggtctctgtcagctcctcaagacaaaggttttttccatggaggacctcaagactgttct
tcgtcgaaggcgtaccattgtcctggaaatcacagctgggatggtatcatttctgtgtca
caagaggcagccttctgtgatcgcagagccagctcgtgctccttgactgtgataaggcca
ctgttggttgagaaaagttcagagcgcccacaacccgggatagcacaacagtggatccag
agtaagagggaagccattgtgagccagatgactgaagcctgcctgaaccaatccctggac
gcccttctgtctcgggacctgatcatgaaggaggactatgaactcattagcaccaaacct
acaaggaccgcaaaagtcagacagctgctagatacctctgacatccaaggagaagagttt
gccagagttatagtacagaagttgaaagacaacaagcagatggggcttcagccttacccg
gaagtacttttggtttccagaacaccatcttcaaatgtccttcaaaataaaaccttataa

DBGET integrated database retrieval system