KEGG   Rattus norvegicus (rat): 362938
Entry
362938            CDS       T01003                                 

Gene name
Scrib
Definition
(RefSeq) protein scribble homolog
  KO
K16175  protein scribble
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    362938 (Scrib)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    362938 (Scrib)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    362938 (Scrib)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362938 (Scrib)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 LRR_9 AbLIM_anchor MscS_porin
Other DBs
NCBI-GeneID: 362938
NCBI-ProteinID: NP_001178808
RGD: 1565055
Ensembl: ENSRNOG00000032574
UniProt: D3ZWS0
Position
7
AA seq 1663 aa
MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELG
GLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LTALPRSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQP
LPSLEDPGQQSSPSESCSDAPLSRVSVIQFEDPLEGEEDAEEAAAEKRGLQRRATPHPSE
LKVMKRGIEERRNEAFVCKPDPSPPSPSEEERRLSAESALSGNSVPSASTASDGEPETLP
AEVQGLGQQEAMPGQEEYPEEDYNEPTVHFAEDTLIPREDGEGEEGQPEAPWPLPSGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAHEEEEE
EENRDEEEGEASMEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQTG
GLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAAHAGVRVGDKLLEVNGVALQDAEHHEA
VEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPLLQPETPVP
LRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDAGIFISRIAEGGAAHRAGTLQVGDRVL
SINGVDMTEARHDHAVSLLTAASTTISLLLERETGGAYPPSPPPHSSSTPTATVAATMTT
AIPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGV
FISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPPPP
GMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLR
LLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLG
HRNSLESISSIDRELSPEGPGKEKELASQTLPWEPESAETTGRNQEPLKLDYRVLAAVPS
AGSLQRGPCATTGGKMTEAPSSPGSQQTKPGVIQPLAQAWPRDSPAPRGRDGPCSPPSPD
ELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQAE
GPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDTGLASDRESLDDEQEAE
QPWAGPSHAGGLSPSSPTPLGGSAPVRTAKAERRHQERLRMQSPELPAPERALSPAERRA
LEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLE
DFGLQTSTSPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLDPSPSPGPQEE
DGEVALVLLGRPSPGTVGPEDMTLCSSRRAMRPGRRGLGPVPS
NT seq 4992 nt   +upstreamnt  +downstreamnt
atgctgaagtgcatcccgctctggcgttgcaaccggcacgtggagtcggtggataagcgg
cattgctcgctgcaggttgtaccagaggagatttaccgctacagtcgtagcctggaggag
ctgctcctcgacgccaaccagctgcgcgagctacctaagcccttcttccggctattgaac
ttgcggaagttgggcctcagtgacaacgagatccagcggctgcctcctgaagtggctaac
ttcatgcaactggtggagctggatgtgtcccggaatgatatccccgagatacctgagagc
ataaagttctgtaaggctctggagattgcagacttcagcgggaaccccctctccaggctt
cccgatggcttcacacagctgcgcagcctggctcacctggctctgaatgatgtgtccctg
caggcactgcctggagatgtgggcaacctggccaatttggtgaccttggaactgcgggag
aacctgcttaaatctctccctgcgtccctgtctttccttgtgaagctagaacagctggat
ctgggaggcaatgacctggaagtgctgcctgacactctgggggctctgcctaacctacgg
gagctgtggctagaccgaaaccaactgtcagcgctgcccccggagctaggcaacctgcgg
cggctggtatgcctggacgtgtcagagaacaggctggaggagctacccgtggagctgggt
gggctggcactgctcacagatctgctgctttcccagaatttgcttcagcggctgccagag
ggcattggtcagctgaagcagctgtctatcctgaaggtggaccagaaccggctatgtgag
gtcactgaggccataggggactgtgagaacctctcggaactgatcctcacagagaacctg
ttaacggctttaccccgctctctgggcaaactgaccaaactgacgaaccttaatgtggac
cggaatcatcttgaggtgctgccacctgaaatcggaggctgcgtagcccttagtgtcctc
tccttgagagacaatcgcctggctgtccttcctcctgagcttgcccatacagctgagctg
catgtgcttgacgtagctgggaaccggctgcggagtctgccgtttgcactcacccacctc
aacctcaaggcactgtggctggctgagaaccaggcacaacccatgctccgcttccagacc
gaggatgatgcccaaactggtgaaaaggtgcttacctgctacctgctgccccagcagccc
ttgccaagtctcgaagaccctggacagcagagcagtccctcagagagctgcagtgatgcc
cctctgagccgtgtcagtgtcatccagtttgaggacccccttgaaggtgaagaagatgct
gaggaagctgcagccgagaagcggggcctacagcgtagggccacacctcatcccagtgag
ctcaaggtgatgaagaggggcattgaggagcgccgaaacgaggccttcgtctgcaagcct
gaccccagcccaccctcaccttcagaggaggagaggaggctgagcgcagagtctgccctg
agtggtaactctgtcccgtcggcaagcacagcctccgatggtgaacctgagaccctcccg
gctgaggtacaagggctaggccagcaagaggccatgcctggtcaggaagagtatccagag
gaagactataatgagcccacagtgcactttgcagaggacacactgatccctagggaagat
ggtgaaggtgaagagggacagcccgaggctccctggccgctgcccagtggccgacagagg
ctcatccgcaaagacacaccccactacaagaagcacttcaagatctctaagctcccacag
cccgaagctgttgtggccctgctgcaaggggtgcagacagacagggagggccccactgcg
ggttggcacaatggcccacacacaccttgggctcctcgagcccatgaggaggaagaggag
gaggagaacagggatgaagaagaaggcgaggccagcatggaagaagatgacaaagaagag
gctgtggcttctgctccctctgtcaagggggtgtcgtttgaccaggccaataacctgctg
atagagcctgctcgcattgaggaggaagagttaacactcacgatcgtgcggcagacaggg
ggcctgggcatcagcatcgcagggggaaagggctctaccccctacaaaggagacgatgag
ggcattttcatctctcgagtgtctgaggagggtcctgcagcccatgctggagtccgagtc
ggtgacaaacttctcgaggtgaatggtgtggccttgcaagatgcagaacaccatgaggct
gtggaagcacttcggggggccggtgctgctgtgcaaatgcgagtgtggagggaaagaatg
gtggagcctgagaatgcagtcaccatcacccctctccgccctgaagatgactatagtccc
cgggagtggcggggagggggcctgcgcctgcccctgcttcagccagagactcctgtaccc
ctccgccagcgccacgctgcctgtcttgtgcgcagtgaaaaggggctgggcttcagcatt
gctggtgggaagggctccacaccttaccgggctggcgatgcgggcatttttatatctcgc
attgcagagggaggggctgcccaccgggcaggcactctacaggttggcgaccgtgttctc
tcgatcaatggagtggacatgactgaggcacggcacgatcatgctgtctccctgctgact
gctgcttccactaccatctccctgcttctggagagggaaactggaggggcttatccaccc
agccccccaccacattcctcttcaacccctactgctactgttgctgctaccatgaccact
gccatccccggagaacctctgctacctagactgtcccctagcctcttggccactgccttg
gaaggaccataccctgtggaggaaatttgcctgcccagggctggtggcccattggggctt
agcattgtaggaggttctgatcactccagccatccgtttggtgtccaggatcctggtgta
ttcatctccaaggtgcttcctcggggccttgctgctcgctgtggccttcgggttggggac
cgcatcctagcagtgaatgggcaggatgttcgggaggccacacatcaggaggcagttagt
gccctgctcaggccctgcctggagctgtgtctgcttgtacggagggacccaccaccccca
ggcatgcgggaactctgcatccagaaggcccctggagagaagctgggtatcagcatccga
ggaggcgccaagggtcatgcggggaacccgtgtgatcctacagatgagggcatctttatc
tccaaggtgagccctacaggagctgccgggcgtgacgggcggctgcgtgtggggctgcgg
ctgctagaagtgaaccaacagagcctcctgggcctcacgcatgctgaggcggtgcagctg
ctgcgcagcgtgggtgacaccctcaccgtgcttgtctgtgatggctttgacaccagcacc
accacagccctggaggtgtccccaggtgtcatagccaacccatttgcagcaggccttggc
cacaggaacagtctggaaagcatttcatccattgaccgggagctgagtcctgaaggccca
ggcaaggagaaagagctggccagtcaaaccctaccctgggagcctgagtctgcagagacc
acgggtcggaatcaagagcccctcaagctggattaccgtgtcctggctgctgtgcccagt
gctgggagtttgcaaagaggaccctgtgcgaccactggagggaagatgactgaggccccc
tcttcccctggcagtcagcaaacaaaaccgggggtgatccagccattggctcaggcctgg
ccaagggactccccagcccccaggggcagagatggtccctgttctccgccctcccctgac
gaactgccagccaatgtgaagcaggcgtacagggccttcgcagctgtgcccaccgtacat
cctcctgagaacagtgctacccagcctccaacacctggtcccgcagcctccccagagcag
ctgtccttccgtgaacgacaaaagtactttgagctggaggtacgggtgcctcaagcagag
ggtcccccaaagcgtgtgtccctggtgggtgctgacgacttgcggaagatgcaggaggag
gaagctcgcaagctgcagcagaagagggcacagatgcttcgggaagaggcagtaacctca
ggacctgacacggggctcgcctcagacagggagtccctggatgatgagcaggaggctgag
cagccctgggccgggccaagccatgcaggaggcctcagcccctcttcacccacacccctg
ggaggcagcgcccctgtgaggacagccaaagctgagcgacgtcatcaggagcggctgcgt
atgcagagccctgagctgcccgccccagagcgggccctgtctcctgcagagcgaagggct
ctagaggccgagaagcgagcactgtggagagcagccagaatgaagtctctggagcaggat
gccctccgtgcacagatggtcctcagcaagtcccaggaaggccgtggcaagagaggaccc
ttggagcggctggctgaggccccttcacctgcacccacaccatcacctacaccattagaa
gactttggcctccagaccagtacctcccctggacgcttgcctttgtctggaaagaagttt
gactacagggccttcgcagccctgccttcttccaggcctgtgtatgacatccagtcacca
gatttcgtggaggagctgaggactttggacccatctcccagtcctggcccacaggaagaa
gatggagaggtggctctggtgctccttggcaggccctcacctggcactgtgggccctgaa
gacatgacgctatgcagtagtcgtcgggccatgcggccaggacgccggggcctgggccct
gtgccctcctag

DBGET integrated database retrieval system