KEGG   Rattus norvegicus (rat): 368128
Entry
368128            CDS       T01003                                 

Gene name
Hpse2
Definition
(RefSeq) inactive heparanase-2 precursor
  KO
K07965  heparanase 2 [EC:3.2.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    368128 (Hpse2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    368128 (Hpse2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    368128 (Hpse2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-  
     368128 (Hpse2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   368128 (Hpse2)
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 368128
NCBI-ProteinID: NP_001129234
RGD: 1307959
Position
1
AA seq 592 aa
MRVLCAFPEAMSSSSSRPPSCLALVALFLALLLPLSLSFHAGNRRPLPVDRATGLKEKTL
ILLDVSTKNPVRTVSENFLSLHLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT
DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIIKSDICLHLSLPCLFLKHPDIYLDLKKKK
KKKYHLLLLAEEYCKTQSYRILSARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSS
ALSLLKYSASKKYNISWELGNEPNNYRSIHGRAVNGSQLGKDYIQLRSLLQPIRIYSRAG
LYGPSIGRPRKNVIALLDGFLKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQ
IRKIQKVVNTYTPGKKIWLEGIVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRI
YAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSV
QLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgagggtgctctgtgctttccctgaagccatgtcctccagcagctcccgccccccctcg
tgcctagccctggtggctctcttcttggctctgcttctccctctctccctttccttccac
gctggaaacaggagacctttgcctgtagacagagctacagggttgaaggaaaagaccctg
attctacttgatgtgagcaccaagaacccagtcaggacagtcagtgagaacttcctctct
ctgcatctggatccgtccatcattcatgatggctggctcgatttcttaagctccaagcgt
ctggtgaccctggcccggggactctcgcccgcctttctgcgcttcgggggcaaaaggacg
gatttcctgcagttccagaacctgagaaatccggcgaaaagccgcgggggcccgggcccg
gattactatctcaaaaactatgaggatgatattattaagtctgacatctgcctacatctt
tctttgccttgtctctttctcaagcaccctgacatttatctggacctaaaaaagaaaaag
aaaaaaaaataccatcttttactacttgctgaagaatattgtaagacacaatcttaccgc
atactttctgccaggtctctagacaaactttataactttgctgattgctctggactccac
ctgatatttgctctaaatgcactgcgtcgtaatcccaataactcctggaacagttctagt
gccctgagcctgttgaagtacagtgccagcaaaaagtacaacatttcttgggaactgggt
aatgaacccaataactatcggagcatccacggccgggcagtaaatggcagtcagttggga
aaggattacatccagctgaggagcctgctgcaacccatccggatttactccagagccggc
ttgtacggccccagtattggacggcccaggaagaacgtcattgccctcctggatggattc
ctgaaggtggcaggaagcacagtagatgcggttacctggcaacattgctacattgatggc
cgggtggtcaaggtgatggacttcctgaaaactcgcctgttagatacactctctgaccag
attaggaaaattcagaaagtggtcaacacatacactccaggaaagaagatttggctggaa
ggcatagtgaccacctcagctggaggcacaaacaatctgtcagattcctacgctgcagga
ttcttatggctaaacactttaggaatgctggccaatcagggcattgatgtcgtgatacga
cattcatttttcgaccacggatacaaccatctggtggaccagaactttaacccattacca
gactattggctttctcttctttacaagcgtctgattggccccaaagtcctggcagtgcat
gtagctgggctccagcggaagcctcggccaggaagagtcatccgagacaaactaaggatc
tatgctcactgtacaaaccaccacaaccacaactatgtccgtggctctatcacacttttc
atcatcaacctacatcgatcaagaaagaaaatcaaactggctgggactctcagggacaag
ctcgtgcaccagtatctgctgcagccctatgggcaggaaggcctaaagtccaagtcagtg
cagctcaatggccagcccttagtgatggtggacgacgggacccttccagaactgaagccc
cgccccctgcgggccggccggacattggtcatccctccggtcaccatgggcttttatgtg
gtcaagaatgtcaatgctttggcttgccgttatcgataa

DBGET integrated database retrieval system