KEGG   Rattus norvegicus (rat): 54243
Entry
54243             CDS       T01003                                 

Gene name
Cr1l
Definition
(RefSeq) complement component receptor 1-like protein isoform 2 precursor
  KO
K04011  complement component (3b/4b) receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04613  Neutrophil extracellular trap formation
rno04640  Hematopoietic cell lineage
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05144  Malaria
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    54243 (Cr1l)
   04610 Complement and coagulation cascades
    54243 (Cr1l)
   04613 Neutrophil extracellular trap formation
    54243 (Cr1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    54243 (Cr1l)
   05152 Tuberculosis
    54243 (Cr1l)
  09174 Infectious disease: parasitic
   05144 Malaria
    54243 (Cr1l)
   05140 Leishmaniasis
    54243 (Cr1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    54243 (Cr1l)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    54243 (Cr1l)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    54243 (Cr1l)
CD molecules [BR:rno04090]
 Proteins
  54243 (Cr1l)
SSDB
Motif
Pfam: Sushi PsaN DUF6341 DUF543
Other DBs
NCBI-GeneID: 54243
NCBI-ProteinID: NP_062174
RGD: 2399
Ensembl: ENSRNOG00000008193
UniProt: Q63135
Structure
PDB: 
2XRB 2XRD 1NTJ

Position
13
AA seq 559 aa
MEASSPLDPVGRLVAFCRGGVHLAVLLLFLSPSTLGQCPAPPLFPYAKPINPTDESTFPV
GTSLKYECRPGYIKRQFSITCEVNSVWTSPQDVCIRKQCETPLDPQNGIVHVNTDIRFGS
SITYTCNEGYRLIGSSSAMCIISDQSVAWDAEAPICESIPCEIPPSIPNGDFFSPNREDF
HYGMVVTYQCNTDARGKKLFNLVGEPSIHCTSIDGQVGVWSGPPPQCIELNKCTPPHVEN
AVIVSKNKSLFSLRDMVEFRCQDGFMMKGDSSVYCRSLNRWEPQLPSCFKVKSCGAFLGE
LPNGHVFVPQNLQLGAKVTFVCNTGYQLKGNSSSHCVLDGVESIWNSSVPVCEQVICKLP
QDMSGFQKGLQMKKDYYYGDNVALECEDGYTLEGSSQSQCQSDASWDPPLPKCVSQVICK
LPQDMSGFQKGLQMKKDYYYGDNVALECEDGYTLEGSSQSQCQSDASWDPPLPKCVSRSN
SGLIAGIFIGIIVLILFIIFSYWMIMKFKKRNSTNEKCKEVGIYLNSKEDSCVQPQSLLT
SQENNSTSSPARNSLTQEV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggaggcttcttcgcctctggaccccgtggggcgccttgtagccttctgccgcggagga
gtgcatctggccgtcctgctgctgttcttgtcgccatctactttgggccagtgcccagcc
ccaccactgtttccttatgccaaacctataaatccaactgatgaatccacgtttcccgtt
ggaacatctttgaagtatgaatgtcgtccaggatatatcaagaggcagttctctatcacc
tgcgaagtaaactcagtgtggacaagtcctcaagacgtgtgtatacgtaaacaatgtgaa
actcctttagatcctcagaatggcatagtacatgtaaacacagacatccggtttggatcc
tctatcacttatacctgtaatgaaggataccgcctcattggttcctcctctgctatgtgc
ataatctctgatcagagcgttgcctgggatgccgaggcacctatttgtgaatcaattcct
tgtgagatacccccaagcattcccaatggagatttcttcagtcctaacagagaagatttt
cattatggaatggtagttacctaccagtgcaacactgatgcgagagggaagaagctcttt
aacctggtgggtgagccctccatacactgtaccagcatcgatggtcaagttggagtctgg
agtggccctcctcctcagtgcattgaactcaacaaatgtactcctccccatgttgaaaat
gcagtcatagtgtctaaaaacaaaagcttgttttccttaagggatatggtggagtttaga
tgtcaggatggctttatgatgaaaggagacagcagtgtgtattgtcgatccctaaacaga
tgggagcctcagttaccaagctgcttcaaggtgaaatcctgtggtgctttcctgggtgag
cttcctaatgggcatgtattcgttccacaaaatcttcaactcggggccaaagtgaccttt
gtttgtaatacagggtatcaattaaaaggcaattcttctagtcattgtgttcttgatgga
gtggaaagcatttggaatagcagcgttcctgtgtgtgaacaagtgatatgtaaactccct
caggatatgagtggattccagaaagggttgcaaatgaaaaaagattattactatggagat
aatgtagccttggaatgtgaggatgggtatactctagaaggcagttctcagagccagtgc
cagtccgatgccagctgggatcctcctctgcccaaatgtgtctctcaagtgatatgtaaa
ctccctcaggatatgagtggattccagaaagggttgcaaatgaaaaaagattattactat
ggagataatgtagccttggaatgtgaggatgggtatactctagaaggcagttctcagagc
cagtgccagtccgatgccagctgggatcctcctctgcccaaatgtgtctctcgctcaaac
agtggtctaatagctggaattttcattgggataatcgtccttattttattcatcattttt
tcctactggatgattatgaagtttaaaaaacgcaattccaccaatgaaaagtgtaaagaa
gtgggtatctatttaaattctaaagaagacagctgtgttcagcctcagtctctgctcaca
agtcaggagaacaacagtaccagtagcccagcacggaattcactcactcaagaagtctaa

DBGET integrated database retrieval system