KEGG   Rattus norvegicus (rat): 60341
Entry
60341             CDS       T01003                                 

Symbol
Camkk1
Name
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    60341 (Camkk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60341 (Camkk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     60341 (Camkk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CAMKK family
   60341 (Camkk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal ABC1
Other DBs
NCBI-GeneID: 60341
NCBI-ProteinID: NP_113850
RGD: 62023
Ensembl: ENSRNOG00000018242
UniProt: P97756
Structure
PDB: 
1CKK

Position
10
AA seq 505 aa
MERSPAVCCQDPRAELVERVAAISVAHLEEAEEGPEPASNGVDPPPRARAASVIPGSASR
PTPVRPSLSARKFSLQERPAGSCLEAQVGPYSTGPASHMSPRAWRRPTIESHHVAISDTE
DCVQLNQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
APQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDTGQSFSGKALDVWATGVTLYCFVYGKCPFIDEYILA
LHRKIKNEAVVFPEEPEVSEELKDLILKMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSE
EEHCSVVEVTEEEVKNSVKLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LLKEGCGEGGKSPELPGVQEDEAAS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggagcgcagtccagccgtctgctgccaagaccctcgagcggaactggtagagcgggtg
gcagccatcagtgtggcccacctagaagaggcagaggagggcccagagcctgccagcaat
ggtgtggaccccccaccccgggccagagctgcctctgtgatccctggcagtgcttcaaga
cccacaccagtgcgtcccagcctctctgctagaaagttctccctgcaggaaagaccagcg
ggaagctgtctagaggctcaggttgggccttactctacaggacctgccagtcacatgtct
cctcgggcttggcggagacccaccatcgagtcccaccatgtggccatctcagacacagag
gactgtgtgcaactgaaccagtacaagctgcagagtgagattggcaagggtgcctatggt
gtggtgaggctggcctacaatgaaagggaagacagacactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttcctcgccgtcctcccccgagagggtcccaa
gctcctcagggagggccagccaaacagctgctgcccctggagcgtgtataccaggagatt
gccattttaaagaaactggaccacgtgaatgtagtcaagttgatcgaggtcctggatgat
cctgctgaagacaatctctatttggtgtttgacctcctgagaaagggaccagtcatggaa
gtgccctgcgacaagcccttcccagaggagcaagctcgcctctacctccgggacatcatc
ctgggcctcgagtacttgcactgccagaagattgtgcacagggacatcaagccgtccaat
ctgctccttggggacgatgggcacgtgaagatcgccgactttggtgtcagcaaccagttt
gaggggaatgatgctcagctgtccagtacggcagggaccccagcattcatggccccggag
gccatctctgacaccggccagagcttcagtgggaaggccttggatgtatgggccactggg
gttacactgtattgttttgtctacgggaagtgcccattcattgatgagtacatcctggcc
ctgcacagaaagatcaagaatgaggccgtggtgttccctgaggagccggaggtcagcgag
gaactcaaagacctgatcctgaagatgctagacaagaatcctgaaacaagaattggggtg
tctgatatcaagttacacccttgggtgaccaagcatggagaggagcccctcccttcagag
gaggaacactgcagtgtggtagaggtgactgaggaggaggtgaagaactcagtcaagctc
atccccagctggaccactgtgatcctggtcaagtctatgctgagaaagcgttcctttgga
aacccatttgagccccaagcacgcagggaagaaagatctatgtctgcgccaggaaactta
ctgttgaaagaaggatgtggagaagggggcaaaagcccagagcttcccggagtccaggaa
gatgaggctgcatcctga

KEGG   Rattus norvegicus (rat): 83506
Entry
83506             CDS       T01003                                 

Symbol
Camkk2
Name
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04936  Alcoholic liver disease
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    83506 (Camkk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83506 (Camkk2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    83506 (Camkk2)
   04921 Oxytocin signaling pathway
    83506 (Camkk2)
  09149 Aging
   04211 Longevity regulating pathway
    83506 (Camkk2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    83506 (Camkk2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    83506 (Camkk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83506 (Camkk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     83506 (Camkk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CAMKK family
   83506 (Camkk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal ABC1
Other DBs
NCBI-GeneID: 83506
NCBI-ProteinID: NP_112628
RGD: 620092
Ensembl: ENSRNOG00000001309
UniProt: O88831
Position
12
AA seq 587 aa
MSSCVSSQPTSDRAAPQDELGSGGVSRESQKPCEALRGLSSLSIHLGMESFIVVTECEPG
RGVDLSLARDQPLEADGQELPLDASEPESRSLLSGGKMSLQERSQGGPASSSSLDMNGRC
ICPSLSYSPASSPQSSPRMPRRPTVESHHVSITGLQDCVQLNQYTLKDEIGKGSYGVVKL
AYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILK
KLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIE
YLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSE
TRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLKD
LITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSL
ATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTREWEPLSEPKEARQRRQPP
GPRASPCGGGGSALVKGGPCVESCGAPAPGSPPRTPPQQPEEAMEPE
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccaccagcgaccgggcggccccccaggatgagctg
ggaagcgggggtgtcagccgggaaagccagaagccctgcgaggcactgcggggactctca
tccttaagcatccacttgggcatggaatccttcatcgtggtcaccgagtgtgaaccaggc
cggggcgtggacctcagcctggccagagaccaacctctggaggccgatggccaggaactc
cctctggatgcctcggaacctgagtcacggtccctgctttctggtggcaagatgtccctc
caggagcggtcccagggcgggccggcgtccagcagcagcctggacatgaatggacgctgc
atctgcccatccctgtcctactcaccagccagctccccacagtcctctccccggatgccc
cggcggcccacagtggagtcgcaccacgtctccatcacgggtttgcaggactgtgtgcag
ctgaatcagtacacgctgaaggatgaaattggaaagggctcctatggcgttgtcaagctg
gcctacaatgaaaatgacaatacttattatgcaatgaaagtgctgtccaaaaagaagctg
atccgacaggccggctttccacgtcgccccccacctcgaggtactcgcccagctccaggg
ggctgcatccagcccaggggccccatcgagcaggtgtatcaggaaattgccatcctcaag
aagctggatcaccccaacgtggtgaagctggtggaggtcctggatgaccctaacgaggac
catctgtacatggtgtttgaactggtcaaccaagggcctgtgatggaagttcccaccctc
aagccactgtctgaagaccaggcccggttctacttccaagatctgatcaaaggcattgag
tacttacactaccagaagatcattcaccgggacatcaaaccctccaacctcctagtgggg
gaggacgggcacatcaagatagccgacttcggcgtgagcaatgagttcaagggcagcgac
gccttgctgtctaacaccgtgggcacgcctgccttcatggcgcccgagtcgctctcagag
acccggaagatcttctccggaaaggccttggatgtttgggccatgggtgtgacactatac
tgctttgtttttggccagtgccctttcatggatgaacgaatcatgtgtttgcacagtaag
atcaagagtcaggccctggagtttccagaccagcctgacatagccgaagacttgaaagat
ctgatcacccggatgttggacaagaacccagagtccaggattgtggtgcctgaaatcaag
ctgcacccttgggtcacgaggcacggggccgagccactgccgtcggaggacgagaactgc
acactggtcgaggtgaccgaagaggaggtcgagaattcagtcaaacacattcccagcctg
gcaactgtgatcctagtgaagaccatgattcggaaacggtcttttgggaacccatttgaa
ggtagccggcgggaggagcgttccttgtcagcacccggaaacctgctcaccaaaaaacca
accagggagtgggagcccttgtctgagcccaaggaagcaaggcagcgaagacagcctccg
gggcccagagccagcccctgtgggggaggaggaagtgctcttgtgaaaggtggtccctgc
gtggaaagttgcggggctccggcccctggctccccgccacgcacgcctccacagcagccc
gaggaggccatggagccggagtag

DBGET integrated database retrieval system