KEGG   Rattus norvegicus (rat): 60371
Entry
60371             CDS       T01003                                 

Gene name
Birc2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
rno05145  Toxoplasmosis
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    60371 (Birc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    60371 (Birc2)
   04064 NF-kappa B signaling pathway
    60371 (Birc2)
   04668 TNF signaling pathway
    60371 (Birc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    60371 (Birc2)
   04215 Apoptosis - multiple species
    60371 (Birc2)
   04217 Necroptosis
    60371 (Birc2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    60371 (Birc2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    60371 (Birc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60371 (Birc2)
   05202 Transcriptional misregulation in cancer
    60371 (Birc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    60371 (Birc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    60371 (Birc2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    60371 (Birc2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    60371 (Birc2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    60371 (Birc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    60371 (Birc2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    60371 (Birc2)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   60371 (Birc2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    60371 (Birc2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX NikR_C DUF2039
Other DBs
NCBI-GeneID: 60371
NCBI-ProteinID: NP_068520
RGD: 620690
Ensembl: ENSRNOG00000010602
UniProt: Q6P6S1
Position
8
AA seq 589 aa
MENSTVLSNWTKENKEKMKYDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDSPTEKHRQFYPSCSFVQTLLSGGLQSAAKNTSPAKSRFAHSLPL
EQGGIHSSLPSNPLNSRAVEDFSLRMNPCSYAMSTEEARFLSYSMWPLSFLSPAELAKAG
FYYTGPGDRVACFACGGKLSNWEPNDDPLSEHRRHFPHCPFLENTSETQRFSVSNLSMQT
HSARMRTFLYWPSSVLVQPEQLASAGFYYVDHNDDVKCFCCDGGLRCWEPGDDPWIEHAK
WFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTSEEENADPPVVHLGPGENWEDAV
MMNTPVVKAALDMGFSRSLVRQTVQRQILATGENYRTVSDIVSALLNAEDERREEEKERQ
SEETASGDLSLIRKNRMALFQQLTCVIPILDDLLEASVLTKEEHDIIRQKTQIPLQAREL
IDTILVKGNAAASVFKNSLKEVDSTLYEHLFVEKTMKYIPTEDVSGLSLEEQLRRLQEER
TCKVCMDREVSIVFIPCGHLVVCRECAPSLRKCPICRGTIKGTVRTFLS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggagaatagcacagtcttgtcaaattggacaaaagaaaacaaagaaaaaatgaagtat
gacttttcatgtgaactctacagaatgtccacatactcagcttttcccaggggagttcct
gtctcagagaggagtctggctcgtgctggcttttactacacaggtgtcaatgacaaggtc
aagtgcttctgctgtggcctgatgctggacaactggaaacaaggggacagtcccactgag
aagcacagacagttctatcccagctgcagctttgtgcagactttgctttcaggcggtctg
cagtctgcagctaagaacacgtctcctgcgaaaagtagatttgcacactcgctacctctg
gaacaaggtggcattcattccagcctgccctcaaaccctctcaattctagagcagtggaa
gacttctcgttgaggatgaatccctgcagctatgccatgagtacagaagaggccaggttt
ctttcttacagtatgtggccattaagttttctgtccccagcagagctggccaaagcaggc
ttctactacacagggcctggagacagggtggcctgttttgcctgtggtgggaaactgagc
aactgggaaccgaacgatgatcctctgtcagagcacaggagacattttccccactgtcca
tttctggaaaatacttcagaaacgcagaggtttagtgtatccaatctcagtatgcagaca
cactctgctcggatgaggacgtttctgtactggccatcgagtgttcttgttcagcctgag
cagcttgcaagtgctggattttattatgtggatcacaatgatgatgtcaaatgcttttgt
tgtgatggtggcttgagatgttgggaacccggagatgacccctggatagaacatgccaaa
tggtttccaaggtgtgagttcttgatacggatgaagggtcaggagtttgttgatgagatt
caagctagatatcctcatcttcttgagcagctgttgtccacttcagacacctcagaagaa
gaaaatgctgaccctccagttgtgcatctgggccctggagagaattgggaagatgcagtg
atgatgaacacacctgtggttaaagcagccttggatatgggcttcagtaggagcctggtg
agacagacggttcagcgacagatcctggccactggtgagaactacaggacggtcagtgat
attgtctcagcacttctgaatgctgaagatgagagaagagaagaggagaaggagagacag
agtgaagagacggcatcaggtgacttgtcattgattcggaagaatagaatggccctcttc
caacagttgacgtgtgtcattcctatcctggatgatcttcttgaggccagtgtacttaca
aaggaggaacatgatattatcagacagaaaacacagatacccttacaagcaagagagctc
atcgacaccatcttagtcaagggaaatgctgcagccagcgtcttcaaaaactctctgaag
gaagtcgactctacgctatatgaacacttatttgtggagaagacgatgaagtatattccc
acagaagacgtttcaggcttgtcattggaagaacagctgcggagattacaagaagaaaga
acgtgtaaagtgtgtatggacagagaggtctctatcgttttcattccttgtggtcatctg
gtagtctgccgggaatgtgccccttccctgagaaagtgccccatctgcagggggacaatt
aaagggactgtgcgtacgtttctctcatga

KEGG   Rattus norvegicus (rat): 63879
Entry
63879             CDS       T01003                                 

Gene name
Xiap
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04510  Focal adhesion
rno04621  NOD-like receptor signaling pathway
rno05145  Toxoplasmosis
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    63879 (Xiap)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    63879 (Xiap)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    63879 (Xiap)
   04215 Apoptosis - multiple species
    63879 (Xiap)
   04217 Necroptosis
    63879 (Xiap)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    63879 (Xiap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    63879 (Xiap)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    63879 (Xiap)
   05207 Chemical carcinogenesis - receptor activation
    63879 (Xiap)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    63879 (Xiap)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    63879 (Xiap)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    63879 (Xiap)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    63879 (Xiap)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    63879 (Xiap)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    63879 (Xiap)
   03029 Mitochondrial biogenesis [BR:rno03029]
    63879 (Xiap)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     63879 (Xiap)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   63879 (Xiap)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    63879 (Xiap)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    63879 (Xiap)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 SH2_2 Sin3_corepress DUF2039
Other DBs
NCBI-GeneID: 63879
NCBI-ProteinID: NP_071567
RGD: 620692
Ensembl: ENSRNOG00000006967
UniProt: Q9R0I6
Position
X
AA seq 496 aa
MTFNSFEGSRTVVPADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAVDRWQYGDSAVGRHRRISPNCRFINGFYFENGATQSTSPGIQNGQYKSENC
VGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPDYAHLS
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLGESVVRTAEKTPS
VTKKIDDTIFQNPMVQEAIRMGFNFKDIKKTMEEKLQTSGSNYLSLEVLIADLVSAQKDN
SQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCCTVITFKQKIFMS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctagaactgttgtacctgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagcagcagt
cctgtttcagcatcaacattggcgcgagcggggtttctctacactggtgaaggagacacc
gtgcagtgtttcagttgtcacgcggcagtagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaac
ggtgccacacagtctacatctcctggcatccaaaatggccagtacaaatctgaaaactgt
gtgggaaacagaaatcattttgctcttgacaggccgtcggagactcatgcagattatctc
ctgagaactggacaggttgtagatatttcagataccatatacccgaggaacccggccatg
tgtagtgaagaagccagactgaagacgtttcagaactggccagactatgcccatttaagc
cccagagagttagctagtgctggactctactacacggggattgatgatcaagtgcaatgc
ttttgttgtggtggaaaactgaaaaattgggaaccctgtgaccgtgcctggtcagagcac
aggagacactttcccaactgcttcttcgttttgggccggaatgttaatgttcgaagtgag
tctggtgtgagttcagataggaatttcccaaattcaacaaattctccaagaaatccagcc
atggcagaatatgacgcacggatcgttacttttggaacatggctatactcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgct
aagtggtatccagggtgtaaatatctattggatgagaagggacaagaatatataaataat
attcatttaacccattcacttggggaatctgtggtaagaactgctgaaaaaacaccatca
gtaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggattcaacttcaaggacatcaagaaaacaatggaagaaaagctccaaacatctggg
agcaactatctatcacttgaggttctgattgcagatcttgtgagtgctcagaaagataat
tcgcaggatgagtcaagtcagacttcattgcagaaagacatcagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatagtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcggaagcagttgacaaatgt
cccatgtgctgcacagtcattacgttcaagcaaaaaatttttatgtcttaa

KEGG   Rattus norvegicus (rat): 64041
Entry
64041             CDS       T01003                                 

Gene name
Birc5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04390  Hippo signaling pathway
rno05161  Hepatitis B
rno05200  Pathways in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    64041 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64041 (Birc5)
   04215 Apoptosis - multiple species
    64041 (Birc5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64041 (Birc5)
   05207 Chemical carcinogenesis - receptor activation
    64041 (Birc5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    64041 (Birc5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    64041 (Birc5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    64041 (Birc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64041 (Birc5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64041 (Birc5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   64041 (Birc5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     64041 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    64041 (Birc5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 64041
NCBI-ProteinID: NP_071610
RGD: 70499
Ensembl: ENSRNOG00000050819
UniProt: Q9JHY7
Position
10
AA seq 142 aa
MGAPALPPTWQLYLKDHRISTFKNWPFLEDCSCTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQVEELTVSEFLKLDKQRAKNKIAKETNNK
QKEFEETARTVRQSIEQLAALR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgctccggcgctgcccccgacctggcagctgtaccttaaggaccaccgcatctcc
accttcaagaactggcccttcctggaggattgctcctgcaccccagagcggatggcggag
gctggcttcatccactgccctaccgagaatgagcctgatttggcccagtgttttttctgc
tttaaggaactggaaggctgggaaccggatgacaaccctatagaggagcataggaagcac
tcccctggctgcgccttccttacagtcaagaagcaggtggaagaactgaccgtcagcgag
tttttgaaactggacaaacaaagagccaagaacaaaattgcaaaggagaccaacaacaaa
cagaaagagttcgaggagaccgcgaggacggtccgccagtccattgagcagctggctgcc
ttacgctga

KEGG   Rattus norvegicus (rat): 78971
Entry
78971             CDS       T01003                                 

Gene name
Birc3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04621  NOD-like receptor signaling pathway
rno04668  TNF signaling pathway
rno05132  Salmonella infection
rno05145  Toxoplasmosis
rno05168  Herpes simplex virus 1 infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    78971 (Birc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    78971 (Birc3)
   04064 NF-kappa B signaling pathway
    78971 (Birc3)
   04668 TNF signaling pathway
    78971 (Birc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    78971 (Birc3)
   04215 Apoptosis - multiple species
    78971 (Birc3)
   04217 Necroptosis
    78971 (Birc3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    78971 (Birc3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    78971 (Birc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78971 (Birc3)
   05202 Transcriptional misregulation in cancer
    78971 (Birc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    78971 (Birc3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    78971 (Birc3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    78971 (Birc3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    78971 (Birc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    78971 (Birc3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    78971 (Birc3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    78971 (Birc3)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I32: IAP family
   78971 (Birc3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    78971 (Birc3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 Sigma70_ner DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 78971
NCBI-ProteinID: NP_076477
RGD: 621282
Ensembl: ENSRNOG00000005731
UniProt: Q5XIW4 F7FLN8
Position
8
AA seq 638 aa
MAKQWGISLVVKLTKSHEQNYLPGERLLPSPPCRLTMNMVQGSAFLAKLMKSADTFELKY
DFSCELYRLSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFSCGLMLDNWKQGDSPIE
KHRKLYPSCSFVQTLNPANSLEASPQPPLPSTATSTMPSGFAASESTGYFSGSYSSFPSD
PVNFRANQDCPAFSTSPYHFAMNTEKARLLTYQTWPLSFLSPAELAKAGFYYTGPGDRVA
CFACGGKLSNWDRKDDPLSEHRRHFPSCPFLKDVGQFTSQYTVSNLSMQTHAARVRTFST
WPSSALVHPQELASAGFYYTGHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIR
IKGQEFVGQVQAGYPHLLEQLLSTSDSPEDETGEAAIVHLGPGENWEDAVMMNTPVVKAA
LDMGFSRSLVRQTVQRQILATGENYRTVSDLVIGLLDAEDEMREEQTEQEAEEEESDDLT
LIRKNKMVLLQHLTPVTPILDCLLSARVITEQEYDAVKQKPHTLQARTLIDTVLAKGNTA
ATSFRNSLQEIDPGLYRDIFVRQNIRSLPTDDIAALPMEEQLRKLQEERTCKVCMDREVS
LVFIPCGHLVVCKECAPSLRKCPICRGTIKGTVRTFLS
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggcaaagcaatggggtatcagcctagtggtaaaactgaccaaaagtcatgaacaaaac
tacctccccggagaaaggctgcttccttcccctccctgtcgtctcaccatgaacatggtt
caaggcagcgccttcctggccaagctgatgaagagtgccgacacctttgagttgaagtac
gacttttcatgtgagctgtaccgcttgtccacatattcaactttccctgctggagtccct
gtctcagagaggagtctggctcgtgctggcttttactacacaggtgtcaatgacaaggtc
aagtgcttctcctgtggcctgatgctggacaactggaaacaaggggacagtcccatcgag
aagcacagaaagctgtatcccagctgcagctttgtgcagaccctgaatccagccaacagt
ctggaagctagccctcagcctcctcttccttccacagcgacaagcaccatgccctccggc
tttgcagcttccgagagcactggctacttcagtggctcctactcaagctttccctcagac
cctgtgaacttccgcgcaaatcaagactgccctgctttcagcacaagtccctaccacttt
gcaatgaacacggagaaggccagattactcacctatcaaacgtggccgttgtcttttctg
tccccagcagagctggccaaagcaggattctactacacagggcctggagatagagtggcc
tgctttgcgtgtggtgggaaactgagcaactgggatcgtaaggatgatcctctgtcagag
cacaggagacatttccccagctgcccattcttaaaagatgtgggtcagttcacttcacaa
tacactgtctctaacctgagcatgcagacccacgcagcacgtgttagaacgttctctacc
tggccttctagcgctctcgttcatcctcaggaacttgcaagtgcgggcttttattacacg
ggacacagtgatgacgtcaagtgcttttgctgtgatggtgggctaagatgctgggaatct
ggagacgacccctgggtggaacacgccaagtggtttccaaggtgtgagtacttgatcaga
atcaaaggccaagagttcgttggccaagttcaagctggttaccctcatctacttgagcag
ctattatctacgtcagactccccagaggatgagactggagaggcagcaattgtgcatctg
ggccctggagagaattgggaagatgcagtgatgatgaacacacctgtggttaaagcagcc
ttggacatgggcttcagtaggagcctggtgagacagacggttcagcgacagatcctggcc
actggtgagaactacaggacggtcagtgacctcgtgataggcctactggatgcagaagat
gagatgagagaggagcagacggagcaggaggccgaggaggaggagtcagatgatctaaca
ttaatccggaagaacaaaatggtgcttcttcaacatttgacgcctgtgacaccaatcctg
gattgcctcctaagtgccagggtcattaccgaacaggagtacgatgccgtaaaacagaaa
ccacacaccttgcaggcaaggacactgatcgatactgtattagcgaaaggaaacaccgca
gcgacctcattcagaaactccctgcaggaaatcgaccctgggttgtacagagatatattt
gtgcgacagaacattaggagtcttcccacagatgacattgcagctctaccgatggaagaa
cagttgcggaaactccaggaagagagaacgtgtaaagtgtgtatggaccgagaggtgtcc
ctcgttttcattccctgtggccatctggtcgtgtgcaaagaatgtgccccctctctgagg
aagtgtcccatctgcagagggactatcaagggcacagtgcgcacatttctctcctga

DBGET integrated database retrieval system