KEGG   Rattus norvegicus (rat): 60661
Entry
60661             CDS       T01003                                 

Gene name
Max
Definition
(RefSeq) protein max
  KO
K04453  Max protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60661 (Max)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60661 (Max)
   05202 Transcriptional misregulation in cancer
    60661 (Max)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    60661 (Max)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60661 (Max)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    60661 (Max)
SSDB
Motif
Pfam: HLH DUF5716 Filament bZIP_2 SlyX Jnk-SapK_ap_N DUF5595 SLX9 ZapB DUF4763 ATG16 DivIC Csm1_N V_ATPase_I
Other DBs
NCBI-GeneID: 60661
NCBI-ProteinID: NP_071546
RGD: 621101
Ensembl: ENSRNOG00000008049
UniProt: P52164
Position
6
AA seq 160 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGGTISAFDGGSDSSSESEPEEPQNRKKLRMEAS
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaaacgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagcaacagagtatatccagtatatgcgaaggaaaaaccatacg
caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcaacaagtccgt
gcactggagaaggcaagatcaagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc
agctcagagtccgagcctgaggagccccagaacaggaagaaactgcggatggaggccagc
taa

DBGET integrated database retrieval system