KEGG   Rattus norvegicus (rat): 64032
Entry
64032             CDS       T01003                                 

Gene name
Ccn2
Definition
(RefSeq) CCN family member 2 precursor
  KO
K06827  connective tissue growth factor (insulin-like growth factor-binding protein 8)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    64032 (Ccn2)
   04371 Apelin signaling pathway
    64032 (Ccn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64032 (Ccn2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    64032 (Ccn2)
SSDB
Motif
Pfam: TSP1_CCN Cys_knot VWC IGFBP TSP_1
Other DBs
NCBI-GeneID: 64032
NCBI-ProteinID: NP_071602
RGD: 621392
Ensembl: ENSRNOG00000015036
UniProt: Q9R1E9
Position
1
AA seq 347 aa
MLASVAGPVSLALVLLLCTRPATGQDCSAQCQCAAEAAPRCPAGVSLVLDGCGCCRVCAK
QLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGSVYRSGESFQSSCKY
QCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDRTVVGPALAAY
RLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNTFCRLEKQSRLCMVRPC
EADLEENIKKGKKCIRTPKIAKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTTLP
VEFKCPDGEIMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgctcgcctccgtcgcgggtcccgttagcctcgccttggtgctcctcctctgcacccgg
cctgccaccggccaggactgcagcgcgcagtgtcagtgcgcagctgaagcggcgccgcgc
tgccccgccggcgtgagcctggtgctggacggctgcggctgctgccgcgtctgcgccaag
cagctgggagaactgtgcacggagcgtgatccctgcgacccacacaagggtctcttctgc
gacttcggctcccccgccaaccgcaagattggcgtgtgcactgccaaagatggtgcaccc
tgtgtcttcggtgggtccgtgtaccgcagcggcgagtccttccaaagcagttgcaaatac
cagtgcacttgcctggatggggccgtgggctgtgtgcccctgtgcagcatggacgtgcgc
ctgcccagccctgactgccccttcccgagaagggtcaagctgcccgggaaatgctgtgag
gagtgggtgtgtgatgagcccaaggaccgcacagtggttggccctgccctagctgcctac
cgactggaagacacatttggccctgacccaactatgatgcgagccaactgcctggtccag
accacagagtggagcgcctgttctaagacctgtgggatgggcatctccacccgggttacc
aatgacaataccttctgcaggctggagaagcagagtcgtctctgcatggtcaggccctgt
gaagctgacctagaggaaaacattaagaagggcaaaaagtgcatccggacgcctaaaatt
gccaagcctgtcaagtttgagctttctggctgcaccagtgtgaagacctaccgggctaag
ttctgtggggtgtgcacggacggccgctgctgcacaccgcacagaaccaccacactgccg
gtggagttcaagtgccccgatggcgagatcatgaaaaagaacatgatgttcatcaagacc
tgtgcctgccattacaactgtcccggggacaatgacatctttgagtccttgtactacagg
aagatgtatggagacatggcgtaa

DBGET integrated database retrieval system